data_2CTD # _entry.id 2CTD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2CTD pdb_00002ctd 10.2210/pdb2ctd/pdb RCSB RCSB024600 ? ? WWPDB D_1000024600 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk002001773.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CTD _pdbx_database_status.recvd_initial_deposition_date 2005-05-24 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tomizawa, T.' 1 'Kigawa, T.' 2 'Koshiba, S.' 3 'Inoue, M.' 4 'Yokoyama, S.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title 'Solution structure of two zf-C2H2 domains from human Zinc finger protein 512' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tomizawa, T.' 1 ? primary 'Kigawa, T.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Inoue, M.' 4 ? primary 'Yokoyama, S.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Zinc finger protein 512' 10438.925 1 ? ? 'zf-C2H2 domains' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGRIRKEPPVYAAGSLEEQWYLEIVDKGSVSCPTCQAVGRKTIEGLKKHMENCKQEMFTCHHCGKQLRSLAGMKY HVMANHNSLPSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGRIRKEPPVYAAGSLEEQWYLEIVDKGSVSCPTCQAVGRKTIEGLKKHMENCKQEMFTCHHCGKQLRSLAGMKY HVMANHNSLPSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk002001773.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 ARG n 1 9 ILE n 1 10 ARG n 1 11 LYS n 1 12 GLU n 1 13 PRO n 1 14 PRO n 1 15 VAL n 1 16 TYR n 1 17 ALA n 1 18 ALA n 1 19 GLY n 1 20 SER n 1 21 LEU n 1 22 GLU n 1 23 GLU n 1 24 GLN n 1 25 TRP n 1 26 TYR n 1 27 LEU n 1 28 GLU n 1 29 ILE n 1 30 VAL n 1 31 ASP n 1 32 LYS n 1 33 GLY n 1 34 SER n 1 35 VAL n 1 36 SER n 1 37 CYS n 1 38 PRO n 1 39 THR n 1 40 CYS n 1 41 GLN n 1 42 ALA n 1 43 VAL n 1 44 GLY n 1 45 ARG n 1 46 LYS n 1 47 THR n 1 48 ILE n 1 49 GLU n 1 50 GLY n 1 51 LEU n 1 52 LYS n 1 53 LYS n 1 54 HIS n 1 55 MET n 1 56 GLU n 1 57 ASN n 1 58 CYS n 1 59 LYS n 1 60 GLN n 1 61 GLU n 1 62 MET n 1 63 PHE n 1 64 THR n 1 65 CYS n 1 66 HIS n 1 67 HIS n 1 68 CYS n 1 69 GLY n 1 70 LYS n 1 71 GLN n 1 72 LEU n 1 73 ARG n 1 74 SER n 1 75 LEU n 1 76 ALA n 1 77 GLY n 1 78 MET n 1 79 LYS n 1 80 TYR n 1 81 HIS n 1 82 VAL n 1 83 MET n 1 84 ALA n 1 85 ASN n 1 86 HIS n 1 87 ASN n 1 88 SER n 1 89 LEU n 1 90 PRO n 1 91 SER n 1 92 GLY n 1 93 PRO n 1 94 SER n 1 95 SER n 1 96 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ZNF512 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P041018-04 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZN512_HUMAN _struct_ref.pdbx_db_accession Q96ME7 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;RIRKEPPVYAAGSLEEQWYLEIVDKGSVSCPTCQAVGRKTIEGLKKHMENCKQEMFTCHHCGKQLRSLAGMKYHVMANHN SLP ; _struct_ref.pdbx_align_begin 142 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CTD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 90 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q96ME7 _struct_ref_seq.db_align_beg 142 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 224 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 90 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2CTD GLY A 1 ? UNP Q96ME7 ? ? 'cloning artifact' 1 1 1 2CTD SER A 2 ? UNP Q96ME7 ? ? 'cloning artifact' 2 2 1 2CTD SER A 3 ? UNP Q96ME7 ? ? 'cloning artifact' 3 3 1 2CTD GLY A 4 ? UNP Q96ME7 ? ? 'cloning artifact' 4 4 1 2CTD SER A 5 ? UNP Q96ME7 ? ? 'cloning artifact' 5 5 1 2CTD SER A 6 ? UNP Q96ME7 ? ? 'cloning artifact' 6 6 1 2CTD GLY A 7 ? UNP Q96ME7 ? ? 'cloning artifact' 7 7 1 2CTD SER A 91 ? UNP Q96ME7 ? ? 'cloning artifact' 91 8 1 2CTD GLY A 92 ? UNP Q96ME7 ? ? 'cloning artifact' 92 9 1 2CTD PRO A 93 ? UNP Q96ME7 ? ? 'cloning artifact' 93 10 1 2CTD SER A 94 ? UNP Q96ME7 ? ? 'cloning artifact' 94 11 1 2CTD SER A 95 ? UNP Q96ME7 ? ? 'cloning artifact' 95 12 1 2CTD GLY A 96 ? UNP Q96ME7 ? ? 'cloning artifact' 96 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.06mM zf-C2H2 domains U-15N,13C; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.25mM ZnCl2; 1mM IDA; 0.02% NaN3; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2CTD _pdbx_nmr_refine.method 'torsion angle dynamics, restrainted molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2CTD _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2CTD _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.6 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9295 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2CTD _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2CTD _struct.title 'Solution structure of two zf-C2H2 domains from human Zinc finger protein 512' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CTD _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text ;Zinc binding, two zf-C2H2 domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 20 ? LYS A 32 ? SER A 20 LYS A 32 1 ? 13 HELX_P HELX_P2 2 THR A 47 ? LYS A 59 ? THR A 47 LYS A 59 1 ? 13 HELX_P HELX_P3 3 SER A 74 ? HIS A 86 ? SER A 74 HIS A 86 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 37 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 37 A ZN 201 1_555 ? ? ? ? ? ? ? 2.368 ? ? metalc2 metalc ? ? A CYS 40 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 40 A ZN 201 1_555 ? ? ? ? ? ? ? 2.330 ? ? metalc3 metalc ? ? A HIS 54 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 54 A ZN 201 1_555 ? ? ? ? ? ? ? 2.364 ? ? metalc4 metalc ? ? A CYS 58 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 58 A ZN 201 1_555 ? ? ? ? ? ? ? 2.331 ? ? metalc5 metalc ? ? A CYS 65 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 65 A ZN 401 1_555 ? ? ? ? ? ? ? 2.348 ? ? metalc6 metalc ? ? A CYS 68 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 68 A ZN 401 1_555 ? ? ? ? ? ? ? 2.326 ? ? metalc7 metalc ? ? A HIS 81 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 81 A ZN 401 1_555 ? ? ? ? ? ? ? 2.374 ? ? metalc8 metalc ? ? A HIS 86 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 86 A ZN 401 1_555 ? ? ? ? ? ? ? 2.337 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 35 ? SER A 36 ? VAL A 35 SER A 36 A 2 GLY A 44 ? ARG A 45 ? GLY A 44 ARG A 45 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id VAL _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 35 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 35 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ARG _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 45 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ARG _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 45 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 37 ? CYS A 37 . ? 1_555 ? 2 AC1 4 CYS A 40 ? CYS A 40 . ? 1_555 ? 3 AC1 4 HIS A 54 ? HIS A 54 . ? 1_555 ? 4 AC1 4 CYS A 58 ? CYS A 58 . ? 1_555 ? 5 AC2 4 CYS A 65 ? CYS A 65 . ? 1_555 ? 6 AC2 4 CYS A 68 ? CYS A 68 . ? 1_555 ? 7 AC2 4 HIS A 81 ? HIS A 81 . ? 1_555 ? 8 AC2 4 HIS A 86 ? HIS A 86 . ? 1_555 ? # _database_PDB_matrix.entry_id 2CTD _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2CTD _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 TRP 25 25 25 TRP TRP A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 MET 55 55 55 MET MET A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 CYS 58 58 58 CYS CYS A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 MET 62 62 62 MET MET A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 CYS 65 65 65 CYS CYS A . n A 1 66 HIS 66 66 66 HIS HIS A . n A 1 67 HIS 67 67 67 HIS HIS A . n A 1 68 CYS 68 68 68 CYS CYS A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 MET 78 78 78 MET MET A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 MET 83 83 83 MET MET A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 ASN 85 85 85 ASN ASN A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 GLY 96 96 96 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 37 ? A CYS 37 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 40 ? A CYS 40 ? 1_555 96.3 ? 2 SG ? A CYS 37 ? A CYS 37 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 54 ? A HIS 54 ? 1_555 113.9 ? 3 SG ? A CYS 40 ? A CYS 40 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 54 ? A HIS 54 ? 1_555 112.6 ? 4 SG ? A CYS 37 ? A CYS 37 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 58 ? A CYS 58 ? 1_555 116.3 ? 5 SG ? A CYS 40 ? A CYS 40 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 58 ? A CYS 58 ? 1_555 117.1 ? 6 NE2 ? A HIS 54 ? A HIS 54 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 58 ? A CYS 58 ? 1_555 101.3 ? 7 SG ? A CYS 65 ? A CYS 65 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 68 ? A CYS 68 ? 1_555 114.4 ? 8 SG ? A CYS 65 ? A CYS 65 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 81 ? A HIS 81 ? 1_555 97.2 ? 9 SG ? A CYS 68 ? A CYS 68 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 81 ? A HIS 81 ? 1_555 116.7 ? 10 SG ? A CYS 65 ? A CYS 65 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 117.0 ? 11 SG ? A CYS 68 ? A CYS 68 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 97.6 ? 12 NE2 ? A HIS 81 ? A HIS 81 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 115.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-24 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 17 4 'Structure model' '_struct_ref_seq_dif.details' 18 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 19 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 20 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 11 ? ? -117.17 72.71 2 1 ALA A 18 ? ? -81.63 40.34 3 1 LYS A 59 ? ? -47.12 89.13 4 1 ALA A 84 ? ? -93.05 -60.26 5 1 HIS A 86 ? ? -89.67 46.97 6 1 SER A 88 ? ? -117.72 78.93 7 1 SER A 91 ? ? -130.04 -60.75 8 1 PRO A 93 ? ? -69.75 0.06 9 2 ARG A 10 ? ? -130.03 -69.99 10 2 LYS A 59 ? ? -173.72 134.60 11 2 LYS A 79 ? ? -39.68 -29.72 12 2 HIS A 86 ? ? -85.74 39.73 13 2 SER A 95 ? ? 35.82 46.80 14 3 ARG A 8 ? ? -101.66 43.24 15 3 ILE A 9 ? ? 39.25 49.87 16 3 PRO A 14 ? ? -69.76 -179.48 17 3 THR A 64 ? ? -161.15 117.84 18 3 HIS A 67 ? ? -55.23 -72.60 19 3 LYS A 79 ? ? -39.10 -26.16 20 3 ASN A 87 ? ? 39.41 35.20 21 3 SER A 88 ? ? -34.59 108.63 22 4 HIS A 86 ? ? -86.26 39.76 23 5 PRO A 14 ? ? -69.76 -176.87 24 5 THR A 39 ? ? -95.19 -62.48 25 5 LYS A 59 ? ? -33.16 93.52 26 5 GLN A 60 ? ? -56.52 108.03 27 5 ALA A 76 ? ? -51.54 -71.23 28 5 ASN A 87 ? ? 74.83 39.76 29 6 TYR A 16 ? ? -48.86 150.42 30 6 ALA A 18 ? ? -83.27 40.36 31 6 PRO A 38 ? ? -69.76 0.17 32 6 ALA A 76 ? ? -47.47 -72.59 33 7 PRO A 14 ? ? -69.76 -168.60 34 7 ALA A 17 ? ? -58.34 174.77 35 7 ALA A 18 ? ? -92.02 39.45 36 7 THR A 39 ? ? -95.56 -61.21 37 7 ASN A 57 ? ? -132.27 -35.81 38 7 THR A 64 ? ? -163.97 116.45 39 7 LYS A 79 ? ? -37.83 -27.35 40 7 ASN A 87 ? ? 34.38 35.05 41 7 SER A 91 ? ? -55.65 99.35 42 8 SER A 2 ? ? -173.12 146.30 43 8 LYS A 11 ? ? -161.47 108.58 44 8 PRO A 14 ? ? -69.85 -174.52 45 8 GLU A 56 ? ? -34.20 -39.28 46 8 LYS A 59 ? ? -89.81 37.59 47 8 ALA A 84 ? ? -107.40 -67.26 48 8 ASN A 87 ? ? 34.16 48.65 49 8 SER A 88 ? ? -170.35 141.81 50 8 PRO A 93 ? ? -69.77 2.90 51 8 SER A 94 ? ? -61.68 75.49 52 9 ARG A 10 ? ? -114.70 50.73 53 9 LYS A 11 ? ? 34.42 37.64 54 9 PRO A 14 ? ? -69.79 -176.38 55 9 ALA A 18 ? ? -82.63 47.08 56 9 THR A 39 ? ? -96.38 -64.75 57 9 THR A 64 ? ? -164.87 117.40 58 9 PRO A 93 ? ? -69.70 3.19 59 10 GLU A 28 ? ? -39.83 -30.85 60 10 CYS A 58 ? ? -43.73 -72.39 61 10 CYS A 65 ? ? -45.72 161.06 62 10 ARG A 73 ? ? -90.26 -61.11 63 10 ALA A 84 ? ? -76.28 -72.41 64 10 PRO A 93 ? ? -69.72 -173.33 65 11 LYS A 11 ? ? -174.18 145.75 66 11 ALA A 18 ? ? -93.11 40.86 67 11 GLU A 28 ? ? -39.88 -30.04 68 11 THR A 64 ? ? -164.40 115.39 69 11 LYS A 79 ? ? -39.58 -25.25 70 11 ASN A 87 ? ? 74.93 47.40 71 11 SER A 88 ? ? -127.97 -50.75 72 11 PRO A 90 ? ? -69.79 97.29 73 12 SER A 2 ? ? -173.19 146.73 74 12 SER A 6 ? ? -125.07 -55.48 75 12 PRO A 14 ? ? -69.74 -170.50 76 12 ALA A 18 ? ? -80.14 42.30 77 12 PRO A 38 ? ? -69.81 3.23 78 12 LYS A 46 ? ? -46.79 -19.66 79 12 ALA A 76 ? ? -39.26 -70.09 80 12 LYS A 79 ? ? -47.43 -19.43 81 12 HIS A 86 ? ? -86.07 -71.05 82 12 ASN A 87 ? ? -85.29 46.20 83 12 PRO A 93 ? ? -69.74 85.08 84 13 SER A 2 ? ? -170.49 140.68 85 13 ILE A 9 ? ? -65.17 95.74 86 13 SER A 20 ? ? -56.67 172.48 87 13 THR A 39 ? ? -96.92 -60.26 88 13 LYS A 59 ? ? -45.50 91.33 89 13 GLN A 60 ? ? -47.07 169.32 90 13 ALA A 84 ? ? -90.26 -68.50 91 13 HIS A 86 ? ? -85.80 36.18 92 13 PRO A 93 ? ? -69.75 95.31 93 14 ARG A 10 ? ? -173.52 130.74 94 14 GLU A 12 ? ? -174.90 141.45 95 14 ALA A 18 ? ? -90.24 41.25 96 14 LYS A 59 ? ? -35.10 104.46 97 14 LYS A 79 ? ? -39.48 -29.25 98 14 ALA A 84 ? ? -98.00 -65.11 99 14 HIS A 86 ? ? -86.67 34.13 100 14 ASN A 87 ? ? -66.60 87.89 101 14 PRO A 90 ? ? -69.74 88.45 102 15 PRO A 14 ? ? -69.76 -179.51 103 15 ALA A 18 ? ? -80.36 47.80 104 15 MET A 62 ? ? -34.44 138.55 105 15 HIS A 86 ? ? -83.42 41.89 106 15 ASN A 87 ? ? -61.04 94.28 107 16 ALA A 18 ? ? -81.18 43.24 108 16 GLU A 28 ? ? -37.29 -31.22 109 16 LYS A 59 ? ? -42.03 109.06 110 16 HIS A 86 ? ? -85.66 49.28 111 16 PRO A 90 ? ? -69.73 -176.81 112 16 SER A 91 ? ? -34.20 123.25 113 17 SER A 5 ? ? -39.87 116.29 114 17 ALA A 17 ? ? -45.88 152.47 115 17 ALA A 18 ? ? -79.99 44.15 116 17 GLU A 61 ? ? -47.89 172.77 117 17 CYS A 65 ? ? -49.66 161.84 118 17 HIS A 86 ? ? -81.86 44.20 119 18 PRO A 14 ? ? -69.77 -175.70 120 18 LYS A 59 ? ? -67.71 -175.21 121 18 MET A 62 ? ? -37.32 153.53 122 18 THR A 64 ? ? -35.70 106.95 123 18 CYS A 65 ? ? -47.83 157.21 124 18 HIS A 86 ? ? -89.90 41.24 125 18 ASN A 87 ? ? -51.10 107.15 126 18 SER A 88 ? ? -164.80 106.67 127 18 PRO A 90 ? ? -69.72 -172.49 128 19 PRO A 14 ? ? -69.75 -176.48 129 19 ALA A 17 ? ? -48.70 163.22 130 19 PRO A 38 ? ? -69.74 0.78 131 19 LYS A 46 ? ? -69.76 0.68 132 19 GLU A 61 ? ? -37.03 131.63 133 19 ALA A 76 ? ? -50.25 -72.17 134 20 PRO A 14 ? ? -69.78 -175.48 135 20 ALA A 17 ? ? -43.43 163.86 136 20 PRO A 38 ? ? -69.74 0.65 137 20 LYS A 46 ? ? -92.58 31.98 138 20 ALA A 84 ? ? -82.83 -72.20 139 20 HIS A 86 ? ? -94.43 51.77 140 20 ASN A 87 ? ? -80.35 44.39 141 20 SER A 91 ? ? -35.98 125.99 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #