data_2CTO # _entry.id 2CTO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2CTO pdb_00002cto 10.2210/pdb2cto/pdb RCSB RCSB024607 ? ? WWPDB D_1000024607 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002012001.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CTO _pdbx_database_status.recvd_initial_deposition_date 2005-05-24 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tomizawa, T.' 1 'Kigawa, T.' 2 'Sato, M.' 3 'Koshiba, S.' 4 'Inoue, M.' 5 'Kamatari, Y.O.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of the HMG box like domain from human hypothetical protein FLJ14904' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tomizawa, T.' 1 ? primary 'Kigawa, T.' 2 ? primary 'Sato, M.' 3 ? primary 'Koshiba, S.' 4 ? primary 'Inoue, M.' 5 ? primary 'Kamatari, Y.O.' 6 ? primary 'Yokoyama, S.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'novel protein' _entity.formula_weight 10367.605 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'HMG box like domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Hypothetical protein FLJ14904' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGMPNRKASRNAYYFFVQEKIPELRRRGLPVARVADAIPYCSSDWALLREEEKEKYAEMAREWRAAQGKDPGPSE KQKPVFTSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGMPNRKASRNAYYFFVQEKIPELRRRGLPVARVADAIPYCSSDWALLREEEKEKYAEMAREWRAAQGKDPGPSE KQKPVFTSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002012001.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 MET n 1 9 PRO n 1 10 ASN n 1 11 ARG n 1 12 LYS n 1 13 ALA n 1 14 SER n 1 15 ARG n 1 16 ASN n 1 17 ALA n 1 18 TYR n 1 19 TYR n 1 20 PHE n 1 21 PHE n 1 22 VAL n 1 23 GLN n 1 24 GLU n 1 25 LYS n 1 26 ILE n 1 27 PRO n 1 28 GLU n 1 29 LEU n 1 30 ARG n 1 31 ARG n 1 32 ARG n 1 33 GLY n 1 34 LEU n 1 35 PRO n 1 36 VAL n 1 37 ALA n 1 38 ARG n 1 39 VAL n 1 40 ALA n 1 41 ASP n 1 42 ALA n 1 43 ILE n 1 44 PRO n 1 45 TYR n 1 46 CYS n 1 47 SER n 1 48 SER n 1 49 ASP n 1 50 TRP n 1 51 ALA n 1 52 LEU n 1 53 LEU n 1 54 ARG n 1 55 GLU n 1 56 GLU n 1 57 GLU n 1 58 LYS n 1 59 GLU n 1 60 LYS n 1 61 TYR n 1 62 ALA n 1 63 GLU n 1 64 MET n 1 65 ALA n 1 66 ARG n 1 67 GLU n 1 68 TRP n 1 69 ARG n 1 70 ALA n 1 71 ALA n 1 72 GLN n 1 73 GLY n 1 74 LYS n 1 75 ASP n 1 76 PRO n 1 77 GLY n 1 78 PRO n 1 79 SER n 1 80 GLU n 1 81 LYS n 1 82 GLN n 1 83 LYS n 1 84 PRO n 1 85 VAL n 1 86 PHE n 1 87 THR n 1 88 SER n 1 89 GLY n 1 90 PRO n 1 91 SER n 1 92 SER n 1 93 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene FLJ14904 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050125-12 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q96JY0_HUMAN _struct_ref.pdbx_db_accession Q96JY0 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MPNRKASRNAYYFFVQEKIPELRRRGLPVARVADAIPYCSSDWALLREEEKEKYAEMAREWRAAQGKDPGPSEKQKPVFT ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CTO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 87 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q96JY0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 80 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 87 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2CTO GLY A 1 ? UNP Q96JY0 ? ? 'cloning artifact' 1 1 1 2CTO SER A 2 ? UNP Q96JY0 ? ? 'cloning artifact' 2 2 1 2CTO SER A 3 ? UNP Q96JY0 ? ? 'cloning artifact' 3 3 1 2CTO GLY A 4 ? UNP Q96JY0 ? ? 'cloning artifact' 4 4 1 2CTO SER A 5 ? UNP Q96JY0 ? ? 'cloning artifact' 5 5 1 2CTO SER A 6 ? UNP Q96JY0 ? ? 'cloning artifact' 6 6 1 2CTO GLY A 7 ? UNP Q96JY0 ? ? 'cloning artifact' 7 7 1 2CTO SER A 88 ? UNP Q96JY0 ? ? 'cloning artifact' 88 8 1 2CTO GLY A 89 ? UNP Q96JY0 ? ? 'cloning artifact' 89 9 1 2CTO PRO A 90 ? UNP Q96JY0 ? ? 'cloning artifact' 90 10 1 2CTO SER A 91 ? UNP Q96JY0 ? ? 'cloning artifact' 91 11 1 2CTO SER A 92 ? UNP Q96JY0 ? ? 'cloning artifact' 92 12 1 2CTO GLY A 93 ? UNP Q96JY0 ? ? 'cloning artifact' 93 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.06mM HMG box like domain U-15N, 13C; 20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2CTO _pdbx_nmr_refine.method 'torsion angle dynamics, restrainted molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2CTO _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2CTO _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.6 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9295 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2CTO _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2CTO _struct.title 'Solution structure of the HMG box like domain from human hypothetical protein FLJ14904' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CTO _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;high mobility group box domain, helix-turn-helix, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 16 ? GLU A 24 ? ASN A 16 GLU A 24 1 ? 9 HELX_P HELX_P2 2 LYS A 25 ? GLY A 33 ? LYS A 25 GLY A 33 1 ? 9 HELX_P HELX_P3 3 ARG A 38 ? ILE A 43 ? ARG A 38 ILE A 43 1 ? 6 HELX_P HELX_P4 4 CYS A 46 ? LEU A 53 ? CYS A 46 LEU A 53 1 ? 8 HELX_P HELX_P5 5 ARG A 54 ? ASP A 75 ? ARG A 54 ASP A 75 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2CTO _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2CTO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 TRP 50 50 50 TRP TRP A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 TRP 68 68 68 TRP TRP A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 GLY 93 93 93 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-24 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 10 ? ? -163.27 112.23 2 1 PRO A 35 ? ? -69.74 87.92 3 1 SER A 79 ? ? -166.74 110.02 4 1 GLN A 82 ? ? -174.84 148.80 5 1 PRO A 84 ? ? -69.73 93.57 6 2 ARG A 15 ? ? -49.75 153.35 7 2 PRO A 35 ? ? -69.80 82.80 8 2 LYS A 74 ? ? -84.98 39.39 9 2 SER A 79 ? ? -38.03 138.74 10 2 GLU A 80 ? ? -90.16 -74.88 11 2 PRO A 84 ? ? -69.72 91.47 12 3 SER A 5 ? ? -41.83 152.85 13 3 ARG A 11 ? ? -35.62 -39.29 14 3 PRO A 35 ? ? -69.75 82.65 15 3 SER A 47 ? ? -36.05 -34.84 16 3 LYS A 74 ? ? -49.19 156.38 17 3 PRO A 76 ? ? -69.78 1.87 18 3 PRO A 90 ? ? -69.81 92.03 19 4 PRO A 9 ? ? -69.71 98.12 20 4 ASN A 10 ? ? -51.40 101.93 21 4 ARG A 11 ? ? -81.86 47.65 22 4 PRO A 35 ? ? -69.82 80.02 23 4 LYS A 74 ? ? -35.37 124.45 24 4 PRO A 78 ? ? -69.76 95.70 25 5 PRO A 35 ? ? -69.84 93.11 26 5 SER A 47 ? ? -36.83 -29.47 27 5 LYS A 74 ? ? -88.56 38.95 28 5 ASP A 75 ? ? -37.93 141.21 29 5 PHE A 86 ? ? -174.14 127.92 30 5 PRO A 90 ? ? -69.73 88.18 31 6 PRO A 35 ? ? -69.77 84.65 32 6 SER A 47 ? ? -38.62 -31.39 33 7 SER A 2 ? ? -125.70 -51.12 34 7 ALA A 17 ? ? -33.29 -36.32 35 7 PRO A 35 ? ? -69.83 85.10 36 7 SER A 47 ? ? -34.93 -35.88 37 7 ASP A 75 ? ? -174.59 140.70 38 7 SER A 79 ? ? -52.01 104.56 39 7 PRO A 84 ? ? -69.79 84.93 40 7 SER A 92 ? ? -66.36 81.52 41 8 SER A 2 ? ? 34.50 42.62 42 8 ARG A 11 ? ? -172.28 113.67 43 8 SER A 14 ? ? -52.55 174.67 44 8 ALA A 17 ? ? -37.54 -35.15 45 8 PRO A 35 ? ? -69.78 80.83 46 8 LYS A 81 ? ? -171.70 148.01 47 8 GLN A 82 ? ? -35.08 102.06 48 8 PRO A 84 ? ? -69.77 -164.20 49 8 VAL A 85 ? ? -59.45 104.43 50 9 SER A 3 ? ? -66.62 93.84 51 9 SER A 5 ? ? -169.24 119.02 52 9 ASN A 10 ? ? -173.06 121.66 53 9 PRO A 35 ? ? -69.76 87.17 54 9 SER A 47 ? ? -35.70 -31.42 55 9 LYS A 81 ? ? -103.52 48.47 56 9 PRO A 90 ? ? -69.66 1.48 57 10 SER A 5 ? ? -172.01 128.05 58 10 PRO A 35 ? ? -69.89 84.47 59 10 SER A 47 ? ? -34.41 -37.47 60 10 LYS A 74 ? ? -64.67 98.70 61 11 SER A 2 ? ? -54.06 109.46 62 11 PRO A 35 ? ? -69.71 84.20 63 11 SER A 47 ? ? -38.09 -31.07 64 11 SER A 92 ? ? -59.77 -178.55 65 12 SER A 2 ? ? -56.51 178.91 66 12 ARG A 11 ? ? -121.20 -55.56 67 12 PRO A 35 ? ? -69.81 86.23 68 12 SER A 47 ? ? -37.56 -29.89 69 13 PRO A 35 ? ? -69.77 88.21 70 13 ASP A 75 ? ? -36.46 151.92 71 13 SER A 88 ? ? -38.73 140.12 72 14 SER A 2 ? ? -124.89 -53.64 73 14 ALA A 13 ? ? -131.03 -47.26 74 14 PRO A 35 ? ? -69.68 89.47 75 14 LYS A 74 ? ? 34.33 36.82 76 14 PRO A 76 ? ? -69.73 0.67 77 14 PRO A 78 ? ? -69.77 95.80 78 14 GLN A 82 ? ? -174.98 144.23 79 14 PRO A 84 ? ? -69.79 -179.97 80 14 PRO A 90 ? ? -69.74 2.39 81 15 SER A 2 ? ? -134.16 -58.04 82 15 SER A 14 ? ? -47.10 172.40 83 15 PRO A 35 ? ? -69.78 84.17 84 15 GLN A 82 ? ? -38.63 137.56 85 15 PRO A 84 ? ? -69.72 -167.27 86 15 VAL A 85 ? ? 33.51 44.71 87 16 ALA A 17 ? ? -35.14 -37.30 88 16 PRO A 35 ? ? -69.82 91.92 89 16 SER A 47 ? ? -35.97 -34.31 90 17 SER A 3 ? ? -50.13 172.81 91 17 SER A 5 ? ? -90.92 46.30 92 17 PRO A 9 ? ? -69.68 93.21 93 17 PRO A 35 ? ? -69.82 80.05 94 17 SER A 47 ? ? -36.27 -32.59 95 17 PRO A 76 ? ? -69.74 2.97 96 18 ASN A 10 ? ? -38.70 98.18 97 18 LYS A 12 ? ? -35.51 102.44 98 18 PRO A 35 ? ? -69.68 85.80 99 18 SER A 47 ? ? -36.64 -37.75 100 18 PRO A 78 ? ? -69.76 95.70 101 18 PRO A 90 ? ? -69.71 86.30 102 19 SER A 3 ? ? -170.80 146.44 103 19 ALA A 13 ? ? 37.54 52.60 104 19 PRO A 35 ? ? -69.73 85.99 105 19 SER A 47 ? ? -36.34 -31.09 106 19 LYS A 81 ? ? -173.19 124.49 107 19 PRO A 84 ? ? -69.80 -179.15 108 19 THR A 87 ? ? 35.97 49.57 109 20 SER A 3 ? ? -69.27 90.42 110 20 MET A 8 ? ? -39.19 145.79 111 20 PRO A 9 ? ? -69.86 2.93 112 20 ASN A 10 ? ? -34.60 117.70 113 20 PRO A 35 ? ? -69.72 84.96 114 20 ASP A 75 ? ? -33.57 96.67 115 20 PRO A 76 ? ? -69.71 3.09 116 20 PRO A 84 ? ? -69.83 -175.04 117 20 PRO A 90 ? ? -69.83 2.85 #