data_2CTP # _entry.id 2CTP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2CTP pdb_00002ctp 10.2210/pdb2ctp/pdb RCSB RCSB024608 ? ? WWPDB D_1000024608 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hss001000182.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CTP _pdbx_database_status.recvd_initial_deposition_date 2005-05-24 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kobayashi, N.' 1 'Tochio, N.' 2 'Koshiba, S.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution structure of J-domain from human DnaJ subfamily B menber 12' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kobayashi, N.' 1 ? primary 'Tochio, N.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Yokoyama, S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'DnaJ homolog subfamily B member 12' _entity.formula_weight 8323.118 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment J-domain _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGDYYEILGVSRGASDEDLKKAYRRLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQFGSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGDYYEILGVSRGASDEDLKKAYRRLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQFGSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hss001000182.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 ASP n 1 9 TYR n 1 10 TYR n 1 11 GLU n 1 12 ILE n 1 13 LEU n 1 14 GLY n 1 15 VAL n 1 16 SER n 1 17 ARG n 1 18 GLY n 1 19 ALA n 1 20 SER n 1 21 ASP n 1 22 GLU n 1 23 ASP n 1 24 LEU n 1 25 LYS n 1 26 LYS n 1 27 ALA n 1 28 TYR n 1 29 ARG n 1 30 ARG n 1 31 LEU n 1 32 ALA n 1 33 LEU n 1 34 LYS n 1 35 PHE n 1 36 HIS n 1 37 PRO n 1 38 ASP n 1 39 LYS n 1 40 ASN n 1 41 HIS n 1 42 ALA n 1 43 PRO n 1 44 GLY n 1 45 ALA n 1 46 THR n 1 47 GLU n 1 48 ALA n 1 49 PHE n 1 50 LYS n 1 51 ALA n 1 52 ILE n 1 53 GLY n 1 54 THR n 1 55 ALA n 1 56 TYR n 1 57 ALA n 1 58 VAL n 1 59 LEU n 1 60 SER n 1 61 ASN n 1 62 PRO n 1 63 GLU n 1 64 LYS n 1 65 ARG n 1 66 LYS n 1 67 GLN n 1 68 TYR n 1 69 ASP n 1 70 GLN n 1 71 PHE n 1 72 GLY n 1 73 SER n 1 74 GLY n 1 75 PRO n 1 76 SER n 1 77 SER n 1 78 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene DNAJB12 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P040315-96 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DNJBC_HUMAN _struct_ref.pdbx_db_accession Q9NXW2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DYYEILGVSRGASDEDLKKAYRRLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQFG _struct_ref.pdbx_align_begin 110 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CTP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 72 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9NXW2 _struct_ref_seq.db_align_beg 110 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 174 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 72 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2CTP GLY A 1 ? UNP Q9NXW2 ? ? 'cloning artifact' 1 1 1 2CTP SER A 2 ? UNP Q9NXW2 ? ? 'cloning artifact' 2 2 1 2CTP SER A 3 ? UNP Q9NXW2 ? ? 'cloning artifact' 3 3 1 2CTP GLY A 4 ? UNP Q9NXW2 ? ? 'cloning artifact' 4 4 1 2CTP SER A 5 ? UNP Q9NXW2 ? ? 'cloning artifact' 5 5 1 2CTP SER A 6 ? UNP Q9NXW2 ? ? 'cloning artifact' 6 6 1 2CTP GLY A 7 ? UNP Q9NXW2 ? ? 'cloning artifact' 7 7 1 2CTP SER A 73 ? UNP Q9NXW2 ? ? 'cloning artifact' 73 8 1 2CTP GLY A 74 ? UNP Q9NXW2 ? ? 'cloning artifact' 74 9 1 2CTP PRO A 75 ? UNP Q9NXW2 ? ? 'cloning artifact' 75 10 1 2CTP SER A 76 ? UNP Q9NXW2 ? ? 'cloning artifact' 76 11 1 2CTP SER A 77 ? UNP Q9NXW2 ? ? 'cloning artifact' 77 12 1 2CTP GLY A 78 ? UNP Q9NXW2 ? ? 'cloning artifact' 78 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.36mM DnaJ3 domain U-13C,15N; 20mM Phosphate buffer Na (pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2CTP _pdbx_nmr_refine.method 'Tosion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2CTP _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function,structures with the lowest energy,structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2CTP _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B. A.' 3 'data analysis' KUJIRA 0.9297 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2CTP _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2CTP _struct.title 'Solution structure of J-domain from human DnaJ subfamily B menber 12' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CTP _struct_keywords.pdbx_keywords CHAPERONE _struct_keywords.text ;DnaJ, J-domain, Chaperone, helix-turn-helix, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 8 ? GLY A 14 ? ASP A 8 GLY A 14 1 ? 7 HELX_P HELX_P2 2 SER A 20 ? LEU A 33 ? SER A 20 LEU A 33 1 ? 14 HELX_P HELX_P3 3 ALA A 42 ? SER A 60 ? ALA A 42 SER A 60 1 ? 19 HELX_P HELX_P4 4 ASN A 61 ? PHE A 71 ? ASN A 61 PHE A 71 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2CTP _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2CTP _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 HIS 36 36 36 HIS HIS A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 GLY 78 78 78 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-24 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 3 ? ? -40.10 151.03 2 1 SER A 5 ? ? 37.61 43.03 3 1 ARG A 30 ? ? -36.85 -32.98 4 1 PHE A 71 ? ? -104.62 -66.48 5 2 ASP A 8 ? ? -36.52 149.79 6 2 ARG A 30 ? ? -37.75 -27.91 7 2 LYS A 39 ? ? -99.60 -63.84 8 2 HIS A 41 ? ? -89.43 37.21 9 2 SER A 60 ? ? -37.50 -39.16 10 2 PHE A 71 ? ? -104.15 -69.08 11 2 SER A 73 ? ? 35.62 43.94 12 3 SER A 3 ? ? -102.03 42.04 13 3 ARG A 30 ? ? -34.54 -32.94 14 3 VAL A 58 ? ? -61.00 -71.33 15 3 SER A 60 ? ? -38.37 -27.30 16 3 PHE A 71 ? ? -108.55 -73.96 17 4 SER A 3 ? ? -90.03 -64.71 18 4 ARG A 30 ? ? -34.52 -33.30 19 4 GLU A 47 ? ? -39.29 -30.55 20 4 ILE A 52 ? ? -45.99 -70.81 21 4 VAL A 58 ? ? -52.35 -71.34 22 4 SER A 60 ? ? -37.62 -32.08 23 4 PHE A 71 ? ? -82.77 -73.93 24 5 LYS A 25 ? ? -72.02 -70.38 25 5 ARG A 30 ? ? -34.79 -32.49 26 5 PRO A 43 ? ? -69.83 -167.50 27 5 GLU A 47 ? ? -39.40 -29.88 28 5 ILE A 52 ? ? -49.95 -70.91 29 5 VAL A 58 ? ? -65.30 -71.14 30 5 SER A 60 ? ? -39.17 -26.95 31 5 PHE A 71 ? ? -70.09 -72.98 32 5 PRO A 75 ? ? -69.74 -175.16 33 6 SER A 2 ? ? -99.19 -64.57 34 6 ARG A 30 ? ? -34.77 -32.65 35 6 SER A 60 ? ? -36.20 -34.61 36 6 PHE A 71 ? ? -106.31 -66.76 37 7 ARG A 30 ? ? -37.23 -30.35 38 7 PRO A 43 ? ? -69.72 -168.24 39 7 PRO A 75 ? ? -69.80 94.87 40 8 ARG A 30 ? ? -37.31 -28.66 41 8 PHE A 71 ? ? -88.44 -70.92 42 8 SER A 73 ? ? -52.80 97.78 43 8 PRO A 75 ? ? -69.78 2.83 44 9 SER A 5 ? ? -83.52 42.90 45 9 ARG A 30 ? ? -37.00 -29.05 46 9 GLU A 47 ? ? -39.60 -30.51 47 9 ARG A 65 ? ? -91.12 -60.36 48 9 SER A 76 ? ? -121.17 -51.16 49 10 SER A 2 ? ? -40.31 152.22 50 10 SER A 20 ? ? -64.94 -177.94 51 10 LYS A 25 ? ? -68.11 -70.38 52 10 ARG A 30 ? ? -35.04 -34.21 53 11 TYR A 10 ? ? -37.90 -39.12 54 11 ARG A 30 ? ? -36.05 -30.58 55 11 HIS A 41 ? ? -102.79 45.83 56 11 PHE A 49 ? ? -38.91 -37.28 57 11 VAL A 58 ? ? -80.31 -71.33 58 11 SER A 73 ? ? -42.67 94.14 59 12 ARG A 30 ? ? -34.52 -32.93 60 12 PHE A 49 ? ? -39.79 -39.47 61 12 THR A 54 ? ? -35.86 -31.47 62 13 SER A 5 ? ? -169.87 107.97 63 13 ARG A 30 ? ? -34.60 -32.77 64 13 VAL A 58 ? ? -60.61 -70.38 65 13 PRO A 75 ? ? -69.80 91.85 66 13 SER A 77 ? ? -101.17 42.27 67 14 ARG A 30 ? ? -34.46 -36.26 68 14 LYS A 39 ? ? -91.30 -60.15 69 14 PRO A 75 ? ? -69.83 98.87 70 15 ARG A 30 ? ? -36.66 -36.98 71 15 HIS A 41 ? ? -89.23 38.33 72 15 PHE A 71 ? ? -95.91 -60.46 73 15 SER A 73 ? ? -66.10 81.68 74 16 LYS A 25 ? ? -67.18 -71.99 75 16 ARG A 30 ? ? -37.22 -29.02 76 16 ASP A 38 ? ? -107.50 -62.50 77 16 ILE A 52 ? ? -51.69 -70.70 78 16 VAL A 58 ? ? -50.93 -70.16 79 16 SER A 60 ? ? -34.50 -36.45 80 16 PHE A 71 ? ? -110.99 -72.92 81 17 SER A 5 ? ? -174.84 128.17 82 17 ASP A 8 ? ? -37.79 141.13 83 17 ARG A 30 ? ? -38.78 -26.28 84 17 THR A 54 ? ? -35.89 -32.92 85 17 PRO A 75 ? ? -69.74 93.03 86 18 ASP A 8 ? ? -41.94 159.23 87 18 ARG A 30 ? ? -34.35 -37.50 88 18 LYS A 39 ? ? -132.39 -63.64 89 18 HIS A 41 ? ? -107.43 41.59 90 18 ILE A 52 ? ? -43.53 -71.70 91 18 VAL A 58 ? ? -65.77 -70.04 92 18 SER A 60 ? ? -36.62 -34.43 93 18 SER A 73 ? ? -34.60 125.98 94 18 PRO A 75 ? ? -69.77 2.73 95 18 SER A 76 ? ? -76.63 48.36 96 19 HIS A 41 ? ? -94.48 48.92 97 19 GLU A 47 ? ? -38.82 -35.94 98 19 SER A 60 ? ? -37.90 -27.76 99 19 PHE A 71 ? ? -91.51 -62.11 100 20 SER A 6 ? ? -134.28 -45.18 101 20 ASP A 8 ? ? -42.45 157.04 102 20 ARG A 30 ? ? -35.55 -31.40 103 20 VAL A 58 ? ? -57.58 -71.38 104 20 PHE A 71 ? ? -105.72 52.32 #