data_2CU7 # _entry.id 2CU7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2CU7 pdb_00002cu7 10.2210/pdb2cu7/pdb RCSB RCSB024623 ? ? WWPDB D_1000024623 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk002101882.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CU7 _pdbx_database_status.recvd_initial_deposition_date 2005-05-25 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yoneyama, M.' 1 'Umehara, T.' 2 'Saito, K.' 3 'Tochio, N.' 4 'Koshiba, S.' 5 'Inoue, M.' 6 'Tanaka, A.' 7 'Kigawa, T.' 8 'Yokoyama, S.' 9 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 10 # _citation.id primary _citation.title 'Structural and Functional Differences of SWIRM Domain Subtypes' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 369 _citation.page_first 222 _citation.page_last 238 _citation.year 2007 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17428495 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2007.03.027 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yoneyama, M.' 1 ? primary 'Tochio, N.' 2 ? primary 'Umehara, T.' 3 ? primary 'Koshiba, S.' 4 ? primary 'Inoue, M.' 5 ? primary 'Yabuki, T.' 6 ? primary 'Aoki, M.' 7 ? primary 'Seki, E.' 8 ? primary 'Matsuda, T.' 9 ? primary 'Watanabe, S.' 10 ? primary 'Tomo, Y.' 11 ? primary 'Nishimura, Y.' 12 ? primary 'Harada, T.' 13 ? primary 'Terada, T.' 14 ? primary 'Shirouzu, M.' 15 ? primary 'Hayashizaki, Y.' 16 ? primary 'Ohara, O.' 17 ? primary 'Tanaka, A.' 18 ? primary 'Kigawa, T.' 19 ? primary 'Yokoyama, S.' 20 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'KIAA1915 protein' _entity.formula_weight 8175.361 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SANT domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGYSVKWTIEEKELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNKVKCGLDKETPNQKTG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGYSVKWTIEEKELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNKVKCGLDKETPNQKTG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk002101882.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 TYR n 1 9 SER n 1 10 VAL n 1 11 LYS n 1 12 TRP n 1 13 THR n 1 14 ILE n 1 15 GLU n 1 16 GLU n 1 17 LYS n 1 18 GLU n 1 19 LEU n 1 20 PHE n 1 21 GLU n 1 22 GLN n 1 23 GLY n 1 24 LEU n 1 25 ALA n 1 26 LYS n 1 27 PHE n 1 28 GLY n 1 29 ARG n 1 30 ARG n 1 31 TRP n 1 32 THR n 1 33 LYS n 1 34 ILE n 1 35 SER n 1 36 LYS n 1 37 LEU n 1 38 ILE n 1 39 GLY n 1 40 SER n 1 41 ARG n 1 42 THR n 1 43 VAL n 1 44 LEU n 1 45 GLN n 1 46 VAL n 1 47 LYS n 1 48 SER n 1 49 TYR n 1 50 ALA n 1 51 ARG n 1 52 GLN n 1 53 TYR n 1 54 PHE n 1 55 LYS n 1 56 ASN n 1 57 LYS n 1 58 VAL n 1 59 LYS n 1 60 CYS n 1 61 GLY n 1 62 LEU n 1 63 ASP n 1 64 LYS n 1 65 GLU n 1 66 THR n 1 67 PRO n 1 68 ASN n 1 69 GLN n 1 70 LYS n 1 71 THR n 1 72 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene KIAA1915 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P041018-13 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q5VVJ2_HUMAN _struct_ref.pdbx_db_accession Q5VVJ2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code YSVKWTIEEKELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNKVKCGLDKETPNQKTG _struct_ref.pdbx_align_begin 33 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CU7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 72 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5VVJ2 _struct_ref_seq.db_align_beg 33 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 97 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 72 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2CU7 GLY A 1 ? UNP Q5VVJ2 ? ? 'cloning artifact' 1 1 1 2CU7 SER A 2 ? UNP Q5VVJ2 ? ? 'cloning artifact' 2 2 1 2CU7 SER A 3 ? UNP Q5VVJ2 ? ? 'cloning artifact' 3 3 1 2CU7 GLY A 4 ? UNP Q5VVJ2 ? ? 'cloning artifact' 4 4 1 2CU7 SER A 5 ? UNP Q5VVJ2 ? ? 'cloning artifact' 5 5 1 2CU7 SER A 6 ? UNP Q5VVJ2 ? ? 'cloning artifact' 6 6 1 2CU7 GLY A 7 ? UNP Q5VVJ2 ? ? 'cloning artifact' 7 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120 _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.83mM SANT domain U-15N, 13C; 20mM Acetate buffer Na (pH4.5); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2CU7 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2CU7 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2CU7 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.6 Bruker 1 processing NMRPipe 20020425 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B. A.' 3 'data analysis' KUJIRA 0.9295 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guentert, P.' 5 refinement CYANA 2.0.17 'Guentert, P.' 6 # _exptl.entry_id 2CU7 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2CU7 _struct.title 'Solution structure of the SANT domain of human KIAA1915 protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CU7 _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text ;Nuclear protein, SANT domain, DNA binding, Regulation of transcription, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 13 ? PHE A 27 ? THR A 13 PHE A 27 1 ? 15 HELX_P HELX_P2 2 ARG A 30 ? GLY A 39 ? ARG A 30 GLY A 39 1 ? 10 HELX_P HELX_P3 3 THR A 42 ? VAL A 58 ? THR A 42 VAL A 58 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2CU7 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2CU7 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 TRP 12 12 12 TRP TRP A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 TRP 31 31 31 TRP TRP A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 GLY 72 72 72 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-25 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 6 ? ? -80.34 46.73 2 1 ARG A 29 ? ? -86.50 31.08 3 1 LEU A 44 ? ? -61.55 -70.46 4 1 CYS A 60 ? ? -38.71 129.84 5 1 PRO A 67 ? ? -69.77 2.88 6 2 ARG A 29 ? ? -85.03 32.35 7 2 ALA A 50 ? ? -38.26 -34.83 8 2 LYS A 57 ? ? -46.49 173.46 9 2 VAL A 58 ? ? 39.77 27.71 10 2 LYS A 59 ? ? -41.21 162.79 11 2 LEU A 62 ? ? -83.10 42.61 12 2 ASN A 68 ? ? 36.11 40.71 13 2 THR A 71 ? ? -54.73 99.19 14 3 TYR A 8 ? ? -67.30 93.59 15 3 GLU A 65 ? ? -175.02 134.47 16 4 SER A 2 ? ? -53.22 95.75 17 4 SER A 5 ? ? -89.48 42.45 18 4 VAL A 10 ? ? -93.72 49.58 19 4 ARG A 29 ? ? -90.04 31.38 20 4 LEU A 44 ? ? -60.06 -70.64 21 4 PHE A 54 ? ? -36.58 -29.84 22 4 LYS A 57 ? ? -51.63 -175.03 23 4 VAL A 58 ? ? -33.97 109.57 24 4 LYS A 59 ? ? -34.91 138.07 25 4 PRO A 67 ? ? -69.78 -178.76 26 5 SER A 6 ? ? -101.29 42.79 27 5 ALA A 50 ? ? -36.79 -39.38 28 5 LYS A 64 ? ? -46.06 166.97 29 6 VAL A 10 ? ? -93.54 54.18 30 6 ALA A 50 ? ? -34.02 -36.78 31 6 LYS A 57 ? ? -50.43 -177.88 32 6 VAL A 58 ? ? 37.40 28.17 33 6 LYS A 59 ? ? -50.04 173.51 34 6 CYS A 60 ? ? -64.09 90.22 35 7 SER A 6 ? ? -45.53 163.88 36 7 LEU A 62 ? ? -103.65 76.44 37 7 THR A 71 ? ? -172.80 144.97 38 8 PHE A 54 ? ? -38.29 -27.38 39 8 LYS A 57 ? ? -40.07 160.39 40 9 SER A 5 ? ? 71.27 36.25 41 9 VAL A 43 ? ? -38.70 -38.69 42 9 CYS A 60 ? ? 39.17 48.54 43 9 LEU A 62 ? ? -85.35 32.83 44 9 GLN A 69 ? ? -38.57 144.92 45 10 SER A 6 ? ? -95.55 42.15 46 10 SER A 35 ? ? -37.35 -37.62 47 10 ALA A 50 ? ? -39.85 -39.75 48 10 CYS A 60 ? ? 34.97 42.50 49 10 LYS A 64 ? ? -37.85 152.27 50 11 VAL A 10 ? ? -97.87 51.01 51 11 ARG A 30 ? ? -58.92 105.30 52 11 VAL A 43 ? ? -34.02 -39.92 53 12 SER A 2 ? ? -84.61 42.26 54 12 ARG A 29 ? ? -88.10 30.49 55 12 LEU A 44 ? ? -58.28 -71.06 56 12 LYS A 57 ? ? -36.38 154.89 57 12 ASN A 68 ? ? -106.31 40.18 58 12 LYS A 70 ? ? -43.60 104.20 59 13 VAL A 10 ? ? -95.60 50.23 60 13 ARG A 29 ? ? -89.48 30.17 61 13 CYS A 60 ? ? -104.56 -60.29 62 14 SER A 6 ? ? -96.18 41.88 63 14 VAL A 10 ? ? -34.11 106.06 64 14 ALA A 50 ? ? -36.20 -36.57 65 14 LYS A 59 ? ? -109.27 41.58 66 14 CYS A 60 ? ? -50.80 103.57 67 14 LEU A 62 ? ? -169.21 119.34 68 14 GLN A 69 ? ? -64.17 95.64 69 15 LYS A 11 ? ? -38.66 147.41 70 15 LYS A 59 ? ? -162.70 115.74 71 15 LEU A 62 ? ? -107.43 79.60 72 16 SER A 2 ? ? -65.20 84.30 73 16 LEU A 37 ? ? -56.09 -70.55 74 16 ALA A 50 ? ? -34.00 -34.17 75 16 LYS A 59 ? ? -37.64 153.44 76 16 LYS A 64 ? ? -121.89 -50.52 77 16 PRO A 67 ? ? -69.82 -178.22 78 16 ASN A 68 ? ? -98.25 38.70 79 17 SER A 3 ? ? -83.82 42.61 80 17 PHE A 54 ? ? -37.87 -35.89 81 17 LYS A 59 ? ? -45.67 171.31 82 17 ASP A 63 ? ? -174.23 114.22 83 17 THR A 66 ? ? -170.18 140.99 84 18 SER A 2 ? ? -34.59 127.83 85 18 VAL A 10 ? ? -33.96 107.25 86 18 PRO A 67 ? ? -69.70 87.97 87 19 SER A 2 ? ? -92.44 42.48 88 19 SER A 3 ? ? -126.83 -57.34 89 19 VAL A 10 ? ? -91.93 50.19 90 19 CYS A 60 ? ? -46.14 103.66 91 19 ASP A 63 ? ? -91.93 42.90 92 19 PRO A 67 ? ? -69.76 2.87 93 20 SER A 5 ? ? -129.75 -54.64 94 20 SER A 9 ? ? -91.91 42.31 95 20 VAL A 10 ? ? -34.63 106.48 96 20 ALA A 25 ? ? -91.94 -63.20 97 20 VAL A 43 ? ? -33.39 -34.89 98 20 ASP A 63 ? ? -96.61 39.66 99 20 THR A 71 ? ? -48.26 103.72 #