data_2CU8 # _entry.id 2CU8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2CU8 pdb_00002cu8 10.2210/pdb2cu8/pdb RCSB RCSB024624 ? ? WWPDB D_1000024624 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-25 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site 9 5 'Structure model' chem_comp_atom 10 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 17 4 'Structure model' '_struct_ref_seq_dif.details' 18 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 19 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 20 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CU8 _pdbx_database_status.recvd_initial_deposition_date 2005-05-25 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hss001000714.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yoneyama, M.' 1 'Sasagawa, A.' 2 'Tomizawa, T.' 3 'Tochio, N.' 4 'Koshiba, S.' 5 'Inoue, M.' 6 'Kigawa, T.' 7 'Yokoyama, S.' 8 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 9 # _citation.id primary _citation.title 'Solution structure of the LIM domain of human Cysteine-rich protein 2' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yoneyama, M.' 1 ? primary 'Sasagawa, A.' 2 ? primary 'Tomizawa, T.' 3 ? primary 'Tochio, N.' 4 ? primary 'Koshiba, S.' 5 ? primary 'Inoue, M.' 6 ? primary 'Kigawa, T.' 7 ? primary 'Yokoyama, S.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cysteine-rich protein 2' 8060.214 1 ? ? 'LIM domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CRP2, ESP1 protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGMASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGMASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hss001000714.1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 MET n 1 9 ALA n 1 10 SER n 1 11 LYS n 1 12 CYS n 1 13 PRO n 1 14 LYS n 1 15 CYS n 1 16 ASP n 1 17 LYS n 1 18 THR n 1 19 VAL n 1 20 TYR n 1 21 PHE n 1 22 ALA n 1 23 GLU n 1 24 LYS n 1 25 VAL n 1 26 SER n 1 27 SER n 1 28 LEU n 1 29 GLY n 1 30 LYS n 1 31 ASP n 1 32 TRP n 1 33 HIS n 1 34 LYS n 1 35 PHE n 1 36 CYS n 1 37 LEU n 1 38 LYS n 1 39 CYS n 1 40 GLU n 1 41 ARG n 1 42 CYS n 1 43 SER n 1 44 LYS n 1 45 THR n 1 46 LEU n 1 47 THR n 1 48 PRO n 1 49 GLY n 1 50 GLY n 1 51 HIS n 1 52 ALA n 1 53 GLU n 1 54 HIS n 1 55 ASP n 1 56 GLY n 1 57 LYS n 1 58 PRO n 1 59 PHE n 1 60 CYS n 1 61 HIS n 1 62 LYS n 1 63 PRO n 1 64 CYS n 1 65 TYR n 1 66 ALA n 1 67 THR n 1 68 LEU n 1 69 PHE n 1 70 GLY n 1 71 SER n 1 72 GLY n 1 73 PRO n 1 74 SER n 1 75 SER n 1 76 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene CRIP2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P040614-03 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 TRP 32 32 32 TRP TRP A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 CYS 64 64 64 CYS CYS A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 GLY 76 76 76 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _exptl.entry_id 2CU8 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2CU8 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2CU8 _struct.title 'Solution structure of the LIM domain of human Cysteine-rich protein 2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CU8 _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text ;CRP2, CRIP2, ESP1 protein, zinc-binding, Structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CRIP2_HUMAN _struct_ref.pdbx_db_accession P52943 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFG _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CU8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 70 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P52943 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 63 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 70 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2CU8 GLY A 1 ? UNP P52943 ? ? 'cloning artifact' 1 1 1 2CU8 SER A 2 ? UNP P52943 ? ? 'cloning artifact' 2 2 1 2CU8 SER A 3 ? UNP P52943 ? ? 'cloning artifact' 3 3 1 2CU8 GLY A 4 ? UNP P52943 ? ? 'cloning artifact' 4 4 1 2CU8 SER A 5 ? UNP P52943 ? ? 'cloning artifact' 5 5 1 2CU8 SER A 6 ? UNP P52943 ? ? 'cloning artifact' 6 6 1 2CU8 GLY A 7 ? UNP P52943 ? ? 'cloning artifact' 7 7 1 2CU8 SER A 71 ? UNP P52943 ? ? 'cloning artifact' 71 8 1 2CU8 GLY A 72 ? UNP P52943 ? ? 'cloning artifact' 72 9 1 2CU8 PRO A 73 ? UNP P52943 ? ? 'cloning artifact' 73 10 1 2CU8 SER A 74 ? UNP P52943 ? ? 'cloning artifact' 74 11 1 2CU8 SER A 75 ? UNP P52943 ? ? 'cloning artifact' 75 12 1 2CU8 GLY A 76 ? UNP P52943 ? ? 'cloning artifact' 76 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id PRO _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 63 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id PHE _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 69 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PRO _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 63 _struct_conf.end_auth_comp_id PHE _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 69 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 12 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 12 A ZN 201 1_555 ? ? ? ? ? ? ? 2.365 ? ? metalc2 metalc ? ? A CYS 15 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 15 A ZN 201 1_555 ? ? ? ? ? ? ? 2.325 ? ? metalc3 metalc ? ? A HIS 33 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 33 A ZN 201 1_555 ? ? ? ? ? ? ? 2.330 ? ? metalc4 metalc ? ? A CYS 36 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 36 A ZN 201 1_555 ? ? ? ? ? ? ? 2.329 ? ? metalc5 metalc ? ? A CYS 39 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 39 A ZN 401 1_555 ? ? ? ? ? ? ? 2.315 ? ? metalc6 metalc ? ? A CYS 42 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 42 A ZN 401 1_555 ? ? ? ? ? ? ? 2.338 ? ? metalc7 metalc ? ? A CYS 60 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 60 A ZN 401 1_555 ? ? ? ? ? ? ? 2.322 ? ? metalc8 metalc ? ? A CYS 64 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 64 A ZN 401 1_555 ? ? ? ? ? ? ? 2.305 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 12 ? A CYS 12 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 15 ? A CYS 15 ? 1_555 117.3 ? 2 SG ? A CYS 12 ? A CYS 12 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 33 ? A HIS 33 ? 1_555 90.6 ? 3 SG ? A CYS 15 ? A CYS 15 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 33 ? A HIS 33 ? 1_555 93.6 ? 4 SG ? A CYS 12 ? A CYS 12 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 36 ? A CYS 36 ? 1_555 116.7 ? 5 SG ? A CYS 15 ? A CYS 15 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 36 ? A CYS 36 ? 1_555 115.6 ? 6 ND1 ? A HIS 33 ? A HIS 33 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 36 ? A CYS 36 ? 1_555 118.2 ? 7 SG ? A CYS 39 ? A CYS 39 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 92.0 ? 8 SG ? A CYS 39 ? A CYS 39 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 60 ? A CYS 60 ? 1_555 119.8 ? 9 SG ? A CYS 42 ? A CYS 42 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 60 ? A CYS 60 ? 1_555 96.9 ? 10 SG ? A CYS 39 ? A CYS 39 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 64 ? A CYS 64 ? 1_555 120.3 ? 11 SG ? A CYS 42 ? A CYS 42 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 64 ? A CYS 64 ? 1_555 119.0 ? 12 SG ? A CYS 60 ? A CYS 60 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 64 ? A CYS 64 ? 1_555 106.2 ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LYS 62 A . ? LYS 62 A PRO 63 A ? PRO 63 A 1 -0.14 2 LYS 62 A . ? LYS 62 A PRO 63 A ? PRO 63 A 2 -0.07 3 LYS 62 A . ? LYS 62 A PRO 63 A ? PRO 63 A 3 -0.15 4 LYS 62 A . ? LYS 62 A PRO 63 A ? PRO 63 A 4 -0.07 5 LYS 62 A . ? LYS 62 A PRO 63 A ? PRO 63 A 5 -0.08 6 LYS 62 A . ? LYS 62 A PRO 63 A ? PRO 63 A 6 -0.06 7 LYS 62 A . ? LYS 62 A PRO 63 A ? PRO 63 A 7 -0.12 8 LYS 62 A . ? LYS 62 A PRO 63 A ? PRO 63 A 8 -0.06 9 LYS 62 A . ? LYS 62 A PRO 63 A ? PRO 63 A 9 -0.07 10 LYS 62 A . ? LYS 62 A PRO 63 A ? PRO 63 A 10 -0.16 11 LYS 62 A . ? LYS 62 A PRO 63 A ? PRO 63 A 11 -0.12 12 LYS 62 A . ? LYS 62 A PRO 63 A ? PRO 63 A 12 -0.11 13 LYS 62 A . ? LYS 62 A PRO 63 A ? PRO 63 A 13 -0.16 14 LYS 62 A . ? LYS 62 A PRO 63 A ? PRO 63 A 14 -0.13 15 LYS 62 A . ? LYS 62 A PRO 63 A ? PRO 63 A 15 -0.09 16 LYS 62 A . ? LYS 62 A PRO 63 A ? PRO 63 A 16 -0.14 17 LYS 62 A . ? LYS 62 A PRO 63 A ? PRO 63 A 17 -0.04 18 LYS 62 A . ? LYS 62 A PRO 63 A ? PRO 63 A 18 -0.05 19 LYS 62 A . ? LYS 62 A PRO 63 A ? PRO 63 A 19 -0.05 20 LYS 62 A . ? LYS 62 A PRO 63 A ? PRO 63 A 20 -0.12 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 24 ? SER A 27 ? LYS A 24 SER A 27 A 2 LYS A 30 ? HIS A 33 ? LYS A 30 HIS A 33 B 1 ALA A 52 ? HIS A 54 ? ALA A 52 HIS A 54 B 2 LYS A 57 ? PHE A 59 ? LYS A 57 PHE A 59 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N SER A 27 ? N SER A 27 O LYS A 30 ? O LYS A 30 B 1 2 N HIS A 54 ? N HIS A 54 O LYS A 57 ? O LYS A 57 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 5 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 CYS A 12 ? CYS A 12 . ? 1_555 ? 2 AC1 5 LYS A 14 ? LYS A 14 . ? 1_555 ? 3 AC1 5 CYS A 15 ? CYS A 15 . ? 1_555 ? 4 AC1 5 HIS A 33 ? HIS A 33 . ? 1_555 ? 5 AC1 5 CYS A 36 ? CYS A 36 . ? 1_555 ? 6 AC2 4 CYS A 39 ? CYS A 39 . ? 1_555 ? 7 AC2 4 CYS A 42 ? CYS A 42 . ? 1_555 ? 8 AC2 4 CYS A 60 ? CYS A 60 . ? 1_555 ? 9 AC2 4 CYS A 64 ? CYS A 64 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 6 ? ? -51.30 106.75 2 1 PRO A 13 ? ? -69.84 6.93 3 1 ASP A 16 ? ? 38.41 51.34 4 1 CYS A 60 ? ? -45.14 154.47 5 1 LYS A 62 ? ? 179.79 162.76 6 1 CYS A 64 ? ? -30.21 -76.46 7 1 SER A 75 ? ? -170.43 137.05 8 2 SER A 3 ? ? -37.17 155.03 9 2 PRO A 13 ? ? -69.79 6.20 10 2 ASP A 16 ? ? 36.19 54.14 11 2 SER A 27 ? ? -172.90 114.02 12 2 LEU A 37 ? ? -49.11 86.69 13 2 SER A 43 ? ? 33.94 39.78 14 2 THR A 45 ? ? -47.51 162.47 15 2 PRO A 48 ? ? -69.79 89.92 16 2 LYS A 62 ? ? 178.30 159.34 17 2 CYS A 64 ? ? -29.73 -76.66 18 2 SER A 75 ? ? -67.19 81.63 19 3 PRO A 13 ? ? -69.74 6.60 20 3 SER A 27 ? ? -161.90 119.92 21 3 LEU A 37 ? ? -75.71 49.14 22 3 PRO A 48 ? ? -69.75 3.37 23 3 CYS A 60 ? ? -44.99 157.41 24 3 LYS A 62 ? ? 176.81 161.19 25 3 CYS A 64 ? ? -28.77 -77.14 26 3 THR A 67 ? ? -45.21 -71.07 27 3 LEU A 68 ? ? -37.80 -31.55 28 4 PRO A 13 ? ? -69.80 5.45 29 4 ASP A 16 ? ? 37.15 50.08 30 4 THR A 18 ? ? -68.12 95.99 31 4 LYS A 24 ? ? -66.75 95.62 32 4 SER A 27 ? ? -171.48 123.10 33 4 LEU A 37 ? ? -82.12 39.99 34 4 CYS A 39 ? ? -37.82 149.60 35 4 THR A 45 ? ? -34.50 142.17 36 4 PRO A 48 ? ? -69.76 6.82 37 4 CYS A 60 ? ? -42.14 153.76 38 4 LYS A 62 ? ? 178.57 160.96 39 4 CYS A 64 ? ? -29.67 -76.42 40 4 PHE A 69 ? ? -127.36 -73.59 41 5 SER A 3 ? ? 71.20 42.16 42 5 PRO A 13 ? ? -69.74 6.41 43 5 PHE A 21 ? ? -39.74 -35.97 44 5 SER A 27 ? ? -170.53 122.58 45 5 LEU A 37 ? ? -56.59 80.69 46 5 PRO A 48 ? ? -69.68 93.07 47 5 LYS A 62 ? ? 178.81 157.61 48 5 CYS A 64 ? ? -29.95 -76.81 49 5 SER A 74 ? ? -37.70 103.64 50 6 PRO A 13 ? ? -69.71 3.19 51 6 ASP A 16 ? ? 33.94 53.58 52 6 THR A 18 ? ? -69.09 98.16 53 6 LYS A 24 ? ? -65.90 96.54 54 6 SER A 27 ? ? -174.21 123.48 55 6 SER A 43 ? ? 33.75 36.13 56 6 PRO A 48 ? ? -69.87 92.74 57 6 CYS A 60 ? ? -46.07 156.03 58 6 LYS A 62 ? ? 178.96 161.28 59 6 CYS A 64 ? ? -28.99 -77.43 60 6 THR A 67 ? ? -39.57 -70.72 61 7 PRO A 13 ? ? -69.75 5.52 62 7 ASP A 16 ? ? 34.68 53.69 63 7 SER A 27 ? ? -173.57 129.16 64 7 CYS A 39 ? ? -35.95 149.42 65 7 THR A 45 ? ? -37.74 138.14 66 7 PRO A 48 ? ? -69.72 88.27 67 7 CYS A 60 ? ? -39.67 159.16 68 7 LYS A 62 ? ? 179.15 160.86 69 7 CYS A 64 ? ? -29.25 -76.84 70 7 PHE A 69 ? ? -112.15 56.02 71 7 PRO A 73 ? ? -69.68 92.27 72 8 SER A 5 ? ? -67.10 81.46 73 8 SER A 6 ? ? -45.64 103.95 74 8 PRO A 13 ? ? -69.85 6.89 75 8 ASP A 16 ? ? 35.73 50.90 76 8 SER A 27 ? ? -166.74 113.04 77 8 LEU A 37 ? ? -63.55 75.02 78 8 SER A 43 ? ? 38.79 44.45 79 8 PRO A 48 ? ? -69.78 88.48 80 8 LYS A 62 ? ? 179.25 161.85 81 8 CYS A 64 ? ? -29.61 -76.96 82 9 PRO A 13 ? ? -69.84 6.80 83 9 ASP A 16 ? ? 39.85 50.66 84 9 LEU A 37 ? ? -51.81 86.21 85 9 SER A 43 ? ? 36.94 35.21 86 9 PRO A 48 ? ? -69.70 99.80 87 9 ASP A 55 ? ? 47.89 25.09 88 9 LYS A 62 ? ? 176.78 159.81 89 9 CYS A 64 ? ? -29.40 -77.41 90 9 SER A 75 ? ? -120.01 -57.39 91 10 PRO A 13 ? ? -69.72 6.26 92 10 THR A 18 ? ? -68.73 92.18 93 10 SER A 27 ? ? -172.23 135.62 94 10 LEU A 37 ? ? -61.04 76.20 95 10 SER A 43 ? ? 73.47 48.77 96 10 PRO A 48 ? ? -69.79 93.48 97 10 LYS A 62 ? ? 176.55 157.92 98 10 CYS A 64 ? ? -28.83 -77.47 99 10 PRO A 73 ? ? -69.76 94.10 100 11 MET A 8 ? ? -102.02 42.35 101 11 PRO A 13 ? ? -69.78 7.52 102 11 SER A 27 ? ? -175.15 119.60 103 11 CYS A 39 ? ? -35.10 149.91 104 11 THR A 45 ? ? -33.75 124.13 105 11 PRO A 48 ? ? -69.74 91.44 106 11 CYS A 60 ? ? -46.75 155.33 107 11 LYS A 62 ? ? 177.80 161.19 108 11 CYS A 64 ? ? -29.81 -76.38 109 11 PRO A 73 ? ? -69.74 88.69 110 12 PRO A 13 ? ? -69.84 9.02 111 12 SER A 27 ? ? -174.36 121.21 112 12 LEU A 37 ? ? -56.34 80.94 113 12 PRO A 48 ? ? -69.81 92.88 114 12 ASP A 55 ? ? 74.02 30.77 115 12 CYS A 60 ? ? -43.57 165.70 116 12 LYS A 62 ? ? 178.53 158.70 117 12 CYS A 64 ? ? -29.09 -76.62 118 12 PRO A 73 ? ? -69.72 93.27 119 12 SER A 75 ? ? -173.46 148.85 120 13 MET A 8 ? ? -98.06 43.62 121 13 PRO A 13 ? ? -69.76 6.91 122 13 ASP A 16 ? ? 39.29 49.55 123 13 LEU A 37 ? ? -63.27 74.85 124 13 SER A 43 ? ? 74.84 51.63 125 13 PRO A 48 ? ? -69.80 96.85 126 13 LYS A 62 ? ? 176.31 158.86 127 13 CYS A 64 ? ? -29.08 -77.39 128 13 PHE A 69 ? ? -104.70 -74.24 129 13 SER A 71 ? ? -50.61 108.16 130 14 PRO A 13 ? ? -69.78 5.58 131 14 ASP A 16 ? ? 32.00 54.32 132 14 LYS A 34 ? ? -49.99 -17.15 133 14 LEU A 37 ? ? -80.41 41.18 134 14 CYS A 39 ? ? -39.66 146.80 135 14 PRO A 48 ? ? -69.80 90.24 136 14 LYS A 62 ? ? 178.12 158.40 137 14 CYS A 64 ? ? -30.33 -76.59 138 14 PRO A 73 ? ? -69.82 4.26 139 14 SER A 74 ? ? -31.45 127.71 140 15 PRO A 13 ? ? -69.76 6.72 141 15 ASP A 16 ? ? 39.63 44.62 142 15 LEU A 37 ? ? -91.07 36.24 143 15 SER A 43 ? ? 71.28 51.62 144 15 THR A 45 ? ? -36.19 121.20 145 15 PRO A 48 ? ? -69.78 89.04 146 15 LYS A 62 ? ? 177.72 160.64 147 15 CYS A 64 ? ? -28.96 -77.34 148 15 LEU A 68 ? ? -37.54 -36.36 149 15 PRO A 73 ? ? -69.77 99.47 150 16 PRO A 13 ? ? -69.76 6.09 151 16 THR A 18 ? ? -68.26 87.64 152 16 LYS A 24 ? ? -66.06 97.18 153 16 LYS A 34 ? ? -49.68 -17.19 154 16 LEU A 37 ? ? -54.88 82.07 155 16 CYS A 39 ? ? -35.68 152.09 156 16 THR A 45 ? ? -37.95 153.78 157 16 PRO A 48 ? ? -69.72 85.06 158 16 CYS A 60 ? ? -45.02 159.99 159 16 LYS A 62 ? ? 176.72 158.17 160 16 CYS A 64 ? ? -29.41 -76.89 161 16 SER A 71 ? ? -49.73 98.87 162 16 PRO A 73 ? ? -69.77 96.32 163 16 SER A 74 ? ? -64.40 95.97 164 16 SER A 75 ? ? -39.25 156.75 165 17 SER A 2 ? ? -54.89 107.34 166 17 SER A 5 ? ? -109.79 42.04 167 17 PRO A 13 ? ? -69.78 6.81 168 17 SER A 27 ? ? -175.00 121.22 169 17 SER A 43 ? ? 74.88 52.46 170 17 THR A 45 ? ? -58.02 109.44 171 17 PRO A 48 ? ? -69.76 80.89 172 17 CYS A 60 ? ? -43.12 153.92 173 17 LYS A 62 ? ? 176.85 159.43 174 17 CYS A 64 ? ? -29.05 -76.92 175 17 PRO A 73 ? ? -69.80 -179.59 176 18 PRO A 13 ? ? -69.76 6.57 177 18 ASP A 16 ? ? 32.96 52.88 178 18 SER A 27 ? ? -172.26 121.56 179 18 LYS A 34 ? ? -59.67 -9.63 180 18 SER A 43 ? ? 70.73 48.50 181 18 THR A 45 ? ? -38.01 122.37 182 18 PRO A 48 ? ? -69.74 87.01 183 18 LYS A 62 ? ? 177.97 159.79 184 18 CYS A 64 ? ? -29.46 -76.71 185 18 LEU A 68 ? ? -39.24 -32.45 186 19 PRO A 13 ? ? -69.78 5.22 187 19 ASP A 16 ? ? 35.09 52.47 188 19 LYS A 24 ? ? -65.54 99.42 189 19 LEU A 37 ? ? -47.91 87.73 190 19 SER A 43 ? ? 33.17 49.89 191 19 THR A 45 ? ? -39.45 152.94 192 19 PRO A 48 ? ? -69.71 88.69 193 19 LYS A 62 ? ? 178.49 161.61 194 19 CYS A 64 ? ? -29.53 -76.97 195 19 PRO A 73 ? ? -69.75 98.29 196 19 SER A 74 ? ? -127.05 -60.23 197 20 PRO A 13 ? ? -69.76 5.34 198 20 ASP A 16 ? ? 38.55 46.06 199 20 SER A 27 ? ? -170.59 121.35 200 20 LEU A 37 ? ? -79.12 47.47 201 20 CYS A 39 ? ? -36.15 148.45 202 20 THR A 45 ? ? -36.60 144.66 203 20 PRO A 48 ? ? -69.78 10.06 204 20 LYS A 62 ? ? 177.40 158.58 205 20 CYS A 64 ? ? -29.96 -76.78 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 2CU8 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function,structures with the lowest energy,structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2CU8 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.44mM LIM domain U-15N, 13C; 20mM d-Tris-HCl (pH7.0); 100mM NaCl; 2mM d-DTT; 0.02% NaN3; 0.01mM ZnCl2; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120 _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_refine.entry_id 2CU8 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20020425 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B. A.' 3 'data analysis' KUJIRA 0.9295 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLU N N N N 71 GLU CA C N S 72 GLU C C N N 73 GLU O O N N 74 GLU CB C N N 75 GLU CG C N N 76 GLU CD C N N 77 GLU OE1 O N N 78 GLU OE2 O N N 79 GLU OXT O N N 80 GLU H H N N 81 GLU H2 H N N 82 GLU HA H N N 83 GLU HB2 H N N 84 GLU HB3 H N N 85 GLU HG2 H N N 86 GLU HG3 H N N 87 GLU HE2 H N N 88 GLU HXT H N N 89 GLY N N N N 90 GLY CA C N N 91 GLY C C N N 92 GLY O O N N 93 GLY OXT O N N 94 GLY H H N N 95 GLY H2 H N N 96 GLY HA2 H N N 97 GLY HA3 H N N 98 GLY HXT H N N 99 HIS N N N N 100 HIS CA C N S 101 HIS C C N N 102 HIS O O N N 103 HIS CB C N N 104 HIS CG C Y N 105 HIS ND1 N Y N 106 HIS CD2 C Y N 107 HIS CE1 C Y N 108 HIS NE2 N Y N 109 HIS OXT O N N 110 HIS H H N N 111 HIS H2 H N N 112 HIS HA H N N 113 HIS HB2 H N N 114 HIS HB3 H N N 115 HIS HD1 H N N 116 HIS HD2 H N N 117 HIS HE1 H N N 118 HIS HE2 H N N 119 HIS HXT H N N 120 LEU N N N N 121 LEU CA C N S 122 LEU C C N N 123 LEU O O N N 124 LEU CB C N N 125 LEU CG C N N 126 LEU CD1 C N N 127 LEU CD2 C N N 128 LEU OXT O N N 129 LEU H H N N 130 LEU H2 H N N 131 LEU HA H N N 132 LEU HB2 H N N 133 LEU HB3 H N N 134 LEU HG H N N 135 LEU HD11 H N N 136 LEU HD12 H N N 137 LEU HD13 H N N 138 LEU HD21 H N N 139 LEU HD22 H N N 140 LEU HD23 H N N 141 LEU HXT H N N 142 LYS N N N N 143 LYS CA C N S 144 LYS C C N N 145 LYS O O N N 146 LYS CB C N N 147 LYS CG C N N 148 LYS CD C N N 149 LYS CE C N N 150 LYS NZ N N N 151 LYS OXT O N N 152 LYS H H N N 153 LYS H2 H N N 154 LYS HA H N N 155 LYS HB2 H N N 156 LYS HB3 H N N 157 LYS HG2 H N N 158 LYS HG3 H N N 159 LYS HD2 H N N 160 LYS HD3 H N N 161 LYS HE2 H N N 162 LYS HE3 H N N 163 LYS HZ1 H N N 164 LYS HZ2 H N N 165 LYS HZ3 H N N 166 LYS HXT H N N 167 MET N N N N 168 MET CA C N S 169 MET C C N N 170 MET O O N N 171 MET CB C N N 172 MET CG C N N 173 MET SD S N N 174 MET CE C N N 175 MET OXT O N N 176 MET H H N N 177 MET H2 H N N 178 MET HA H N N 179 MET HB2 H N N 180 MET HB3 H N N 181 MET HG2 H N N 182 MET HG3 H N N 183 MET HE1 H N N 184 MET HE2 H N N 185 MET HE3 H N N 186 MET HXT H N N 187 PHE N N N N 188 PHE CA C N S 189 PHE C C N N 190 PHE O O N N 191 PHE CB C N N 192 PHE CG C Y N 193 PHE CD1 C Y N 194 PHE CD2 C Y N 195 PHE CE1 C Y N 196 PHE CE2 C Y N 197 PHE CZ C Y N 198 PHE OXT O N N 199 PHE H H N N 200 PHE H2 H N N 201 PHE HA H N N 202 PHE HB2 H N N 203 PHE HB3 H N N 204 PHE HD1 H N N 205 PHE HD2 H N N 206 PHE HE1 H N N 207 PHE HE2 H N N 208 PHE HZ H N N 209 PHE HXT H N N 210 PRO N N N N 211 PRO CA C N S 212 PRO C C N N 213 PRO O O N N 214 PRO CB C N N 215 PRO CG C N N 216 PRO CD C N N 217 PRO OXT O N N 218 PRO H H N N 219 PRO HA H N N 220 PRO HB2 H N N 221 PRO HB3 H N N 222 PRO HG2 H N N 223 PRO HG3 H N N 224 PRO HD2 H N N 225 PRO HD3 H N N 226 PRO HXT H N N 227 SER N N N N 228 SER CA C N S 229 SER C C N N 230 SER O O N N 231 SER CB C N N 232 SER OG O N N 233 SER OXT O N N 234 SER H H N N 235 SER H2 H N N 236 SER HA H N N 237 SER HB2 H N N 238 SER HB3 H N N 239 SER HG H N N 240 SER HXT H N N 241 THR N N N N 242 THR CA C N S 243 THR C C N N 244 THR O O N N 245 THR CB C N R 246 THR OG1 O N N 247 THR CG2 C N N 248 THR OXT O N N 249 THR H H N N 250 THR H2 H N N 251 THR HA H N N 252 THR HB H N N 253 THR HG1 H N N 254 THR HG21 H N N 255 THR HG22 H N N 256 THR HG23 H N N 257 THR HXT H N N 258 TRP N N N N 259 TRP CA C N S 260 TRP C C N N 261 TRP O O N N 262 TRP CB C N N 263 TRP CG C Y N 264 TRP CD1 C Y N 265 TRP CD2 C Y N 266 TRP NE1 N Y N 267 TRP CE2 C Y N 268 TRP CE3 C Y N 269 TRP CZ2 C Y N 270 TRP CZ3 C Y N 271 TRP CH2 C Y N 272 TRP OXT O N N 273 TRP H H N N 274 TRP H2 H N N 275 TRP HA H N N 276 TRP HB2 H N N 277 TRP HB3 H N N 278 TRP HD1 H N N 279 TRP HE1 H N N 280 TRP HE3 H N N 281 TRP HZ2 H N N 282 TRP HZ3 H N N 283 TRP HH2 H N N 284 TRP HXT H N N 285 TYR N N N N 286 TYR CA C N S 287 TYR C C N N 288 TYR O O N N 289 TYR CB C N N 290 TYR CG C Y N 291 TYR CD1 C Y N 292 TYR CD2 C Y N 293 TYR CE1 C Y N 294 TYR CE2 C Y N 295 TYR CZ C Y N 296 TYR OH O N N 297 TYR OXT O N N 298 TYR H H N N 299 TYR H2 H N N 300 TYR HA H N N 301 TYR HB2 H N N 302 TYR HB3 H N N 303 TYR HD1 H N N 304 TYR HD2 H N N 305 TYR HE1 H N N 306 TYR HE2 H N N 307 TYR HH H N N 308 TYR HXT H N N 309 VAL N N N N 310 VAL CA C N S 311 VAL C C N N 312 VAL O O N N 313 VAL CB C N N 314 VAL CG1 C N N 315 VAL CG2 C N N 316 VAL OXT O N N 317 VAL H H N N 318 VAL H2 H N N 319 VAL HA H N N 320 VAL HB H N N 321 VAL HG11 H N N 322 VAL HG12 H N N 323 VAL HG13 H N N 324 VAL HG21 H N N 325 VAL HG22 H N N 326 VAL HG23 H N N 327 VAL HXT H N N 328 ZN ZN ZN N N 329 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLU N CA sing N N 67 GLU N H sing N N 68 GLU N H2 sing N N 69 GLU CA C sing N N 70 GLU CA CB sing N N 71 GLU CA HA sing N N 72 GLU C O doub N N 73 GLU C OXT sing N N 74 GLU CB CG sing N N 75 GLU CB HB2 sing N N 76 GLU CB HB3 sing N N 77 GLU CG CD sing N N 78 GLU CG HG2 sing N N 79 GLU CG HG3 sing N N 80 GLU CD OE1 doub N N 81 GLU CD OE2 sing N N 82 GLU OE2 HE2 sing N N 83 GLU OXT HXT sing N N 84 GLY N CA sing N N 85 GLY N H sing N N 86 GLY N H2 sing N N 87 GLY CA C sing N N 88 GLY CA HA2 sing N N 89 GLY CA HA3 sing N N 90 GLY C O doub N N 91 GLY C OXT sing N N 92 GLY OXT HXT sing N N 93 HIS N CA sing N N 94 HIS N H sing N N 95 HIS N H2 sing N N 96 HIS CA C sing N N 97 HIS CA CB sing N N 98 HIS CA HA sing N N 99 HIS C O doub N N 100 HIS C OXT sing N N 101 HIS CB CG sing N N 102 HIS CB HB2 sing N N 103 HIS CB HB3 sing N N 104 HIS CG ND1 sing Y N 105 HIS CG CD2 doub Y N 106 HIS ND1 CE1 doub Y N 107 HIS ND1 HD1 sing N N 108 HIS CD2 NE2 sing Y N 109 HIS CD2 HD2 sing N N 110 HIS CE1 NE2 sing Y N 111 HIS CE1 HE1 sing N N 112 HIS NE2 HE2 sing N N 113 HIS OXT HXT sing N N 114 LEU N CA sing N N 115 LEU N H sing N N 116 LEU N H2 sing N N 117 LEU CA C sing N N 118 LEU CA CB sing N N 119 LEU CA HA sing N N 120 LEU C O doub N N 121 LEU C OXT sing N N 122 LEU CB CG sing N N 123 LEU CB HB2 sing N N 124 LEU CB HB3 sing N N 125 LEU CG CD1 sing N N 126 LEU CG CD2 sing N N 127 LEU CG HG sing N N 128 LEU CD1 HD11 sing N N 129 LEU CD1 HD12 sing N N 130 LEU CD1 HD13 sing N N 131 LEU CD2 HD21 sing N N 132 LEU CD2 HD22 sing N N 133 LEU CD2 HD23 sing N N 134 LEU OXT HXT sing N N 135 LYS N CA sing N N 136 LYS N H sing N N 137 LYS N H2 sing N N 138 LYS CA C sing N N 139 LYS CA CB sing N N 140 LYS CA HA sing N N 141 LYS C O doub N N 142 LYS C OXT sing N N 143 LYS CB CG sing N N 144 LYS CB HB2 sing N N 145 LYS CB HB3 sing N N 146 LYS CG CD sing N N 147 LYS CG HG2 sing N N 148 LYS CG HG3 sing N N 149 LYS CD CE sing N N 150 LYS CD HD2 sing N N 151 LYS CD HD3 sing N N 152 LYS CE NZ sing N N 153 LYS CE HE2 sing N N 154 LYS CE HE3 sing N N 155 LYS NZ HZ1 sing N N 156 LYS NZ HZ2 sing N N 157 LYS NZ HZ3 sing N N 158 LYS OXT HXT sing N N 159 MET N CA sing N N 160 MET N H sing N N 161 MET N H2 sing N N 162 MET CA C sing N N 163 MET CA CB sing N N 164 MET CA HA sing N N 165 MET C O doub N N 166 MET C OXT sing N N 167 MET CB CG sing N N 168 MET CB HB2 sing N N 169 MET CB HB3 sing N N 170 MET CG SD sing N N 171 MET CG HG2 sing N N 172 MET CG HG3 sing N N 173 MET SD CE sing N N 174 MET CE HE1 sing N N 175 MET CE HE2 sing N N 176 MET CE HE3 sing N N 177 MET OXT HXT sing N N 178 PHE N CA sing N N 179 PHE N H sing N N 180 PHE N H2 sing N N 181 PHE CA C sing N N 182 PHE CA CB sing N N 183 PHE CA HA sing N N 184 PHE C O doub N N 185 PHE C OXT sing N N 186 PHE CB CG sing N N 187 PHE CB HB2 sing N N 188 PHE CB HB3 sing N N 189 PHE CG CD1 doub Y N 190 PHE CG CD2 sing Y N 191 PHE CD1 CE1 sing Y N 192 PHE CD1 HD1 sing N N 193 PHE CD2 CE2 doub Y N 194 PHE CD2 HD2 sing N N 195 PHE CE1 CZ doub Y N 196 PHE CE1 HE1 sing N N 197 PHE CE2 CZ sing Y N 198 PHE CE2 HE2 sing N N 199 PHE CZ HZ sing N N 200 PHE OXT HXT sing N N 201 PRO N CA sing N N 202 PRO N CD sing N N 203 PRO N H sing N N 204 PRO CA C sing N N 205 PRO CA CB sing N N 206 PRO CA HA sing N N 207 PRO C O doub N N 208 PRO C OXT sing N N 209 PRO CB CG sing N N 210 PRO CB HB2 sing N N 211 PRO CB HB3 sing N N 212 PRO CG CD sing N N 213 PRO CG HG2 sing N N 214 PRO CG HG3 sing N N 215 PRO CD HD2 sing N N 216 PRO CD HD3 sing N N 217 PRO OXT HXT sing N N 218 SER N CA sing N N 219 SER N H sing N N 220 SER N H2 sing N N 221 SER CA C sing N N 222 SER CA CB sing N N 223 SER CA HA sing N N 224 SER C O doub N N 225 SER C OXT sing N N 226 SER CB OG sing N N 227 SER CB HB2 sing N N 228 SER CB HB3 sing N N 229 SER OG HG sing N N 230 SER OXT HXT sing N N 231 THR N CA sing N N 232 THR N H sing N N 233 THR N H2 sing N N 234 THR CA C sing N N 235 THR CA CB sing N N 236 THR CA HA sing N N 237 THR C O doub N N 238 THR C OXT sing N N 239 THR CB OG1 sing N N 240 THR CB CG2 sing N N 241 THR CB HB sing N N 242 THR OG1 HG1 sing N N 243 THR CG2 HG21 sing N N 244 THR CG2 HG22 sing N N 245 THR CG2 HG23 sing N N 246 THR OXT HXT sing N N 247 TRP N CA sing N N 248 TRP N H sing N N 249 TRP N H2 sing N N 250 TRP CA C sing N N 251 TRP CA CB sing N N 252 TRP CA HA sing N N 253 TRP C O doub N N 254 TRP C OXT sing N N 255 TRP CB CG sing N N 256 TRP CB HB2 sing N N 257 TRP CB HB3 sing N N 258 TRP CG CD1 doub Y N 259 TRP CG CD2 sing Y N 260 TRP CD1 NE1 sing Y N 261 TRP CD1 HD1 sing N N 262 TRP CD2 CE2 doub Y N 263 TRP CD2 CE3 sing Y N 264 TRP NE1 CE2 sing Y N 265 TRP NE1 HE1 sing N N 266 TRP CE2 CZ2 sing Y N 267 TRP CE3 CZ3 doub Y N 268 TRP CE3 HE3 sing N N 269 TRP CZ2 CH2 doub Y N 270 TRP CZ2 HZ2 sing N N 271 TRP CZ3 CH2 sing Y N 272 TRP CZ3 HZ3 sing N N 273 TRP CH2 HH2 sing N N 274 TRP OXT HXT sing N N 275 TYR N CA sing N N 276 TYR N H sing N N 277 TYR N H2 sing N N 278 TYR CA C sing N N 279 TYR CA CB sing N N 280 TYR CA HA sing N N 281 TYR C O doub N N 282 TYR C OXT sing N N 283 TYR CB CG sing N N 284 TYR CB HB2 sing N N 285 TYR CB HB3 sing N N 286 TYR CG CD1 doub Y N 287 TYR CG CD2 sing Y N 288 TYR CD1 CE1 sing Y N 289 TYR CD1 HD1 sing N N 290 TYR CD2 CE2 doub Y N 291 TYR CD2 HD2 sing N N 292 TYR CE1 CZ doub Y N 293 TYR CE1 HE1 sing N N 294 TYR CE2 CZ sing Y N 295 TYR CE2 HE2 sing N N 296 TYR CZ OH sing N N 297 TYR OH HH sing N N 298 TYR OXT HXT sing N N 299 VAL N CA sing N N 300 VAL N H sing N N 301 VAL N H2 sing N N 302 VAL CA C sing N N 303 VAL CA CB sing N N 304 VAL CA HA sing N N 305 VAL C O doub N N 306 VAL C OXT sing N N 307 VAL CB CG1 sing N N 308 VAL CB CG2 sing N N 309 VAL CB HB sing N N 310 VAL CG1 HG11 sing N N 311 VAL CG1 HG12 sing N N 312 VAL CG1 HG13 sing N N 313 VAL CG2 HG21 sing N N 314 VAL CG2 HG22 sing N N 315 VAL CG2 HG23 sing N N 316 VAL OXT HXT sing N N 317 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2CU8 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ #