data_2CUC # _entry.id 2CUC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2CUC pdb_00002cuc 10.2210/pdb2cuc/pdb RCSB RCSB024627 ? ? WWPDB D_1000024627 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id mmt008000206.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CUC _pdbx_database_status.recvd_initial_deposition_date 2005-05-26 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ohnishi, S.' 1 'Kigawa, T.' 2 'Koshiba, S.' 3 'Inoue, M.' 4 'Yokoyama, S.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title 'Solution structure of the SH3 domain of the mouse hypothetical protein SH3RF2' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ohnishi, S.' 1 ? primary 'Kigawa, T.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Inoue, M.' 4 ? primary 'Yokoyama, S.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'SH3 domain containing ring finger 2' _entity.formula_weight 7388.252 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SH3 domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'hypothetical SH3RF2 protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGNMFVALHTYSAHRPEELDLQKGEGIRVLGKYQDGWLKGLSLLTGRTGIFPSDYVIPVSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGNMFVALHTYSAHRPEELDLQKGEGIRVLGKYQDGWLKGLSLLTGRTGIFPSDYVIPVSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier mmt008000206.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 ASN n 1 9 MET n 1 10 PHE n 1 11 VAL n 1 12 ALA n 1 13 LEU n 1 14 HIS n 1 15 THR n 1 16 TYR n 1 17 SER n 1 18 ALA n 1 19 HIS n 1 20 ARG n 1 21 PRO n 1 22 GLU n 1 23 GLU n 1 24 LEU n 1 25 ASP n 1 26 LEU n 1 27 GLN n 1 28 LYS n 1 29 GLY n 1 30 GLU n 1 31 GLY n 1 32 ILE n 1 33 ARG n 1 34 VAL n 1 35 LEU n 1 36 GLY n 1 37 LYS n 1 38 TYR n 1 39 GLN n 1 40 ASP n 1 41 GLY n 1 42 TRP n 1 43 LEU n 1 44 LYS n 1 45 GLY n 1 46 LEU n 1 47 SER n 1 48 LEU n 1 49 LEU n 1 50 THR n 1 51 GLY n 1 52 ARG n 1 53 THR n 1 54 GLY n 1 55 ILE n 1 56 PHE n 1 57 PRO n 1 58 SER n 1 59 ASP n 1 60 TYR n 1 61 VAL n 1 62 ILE n 1 63 PRO n 1 64 VAL n 1 65 SER n 1 66 GLY n 1 67 PRO n 1 68 SER n 1 69 SER n 1 70 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene Sh3rf2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P040802-07 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free system' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8C1E3_MOUSE _struct_ref.pdbx_db_accession Q8C1E3 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code NMFVALHTYSAHRPEELDLQKGEGIRVLGKYQDGWLKGLSLLTGRTGIFPSDYVIPV _struct_ref.pdbx_align_begin 221 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CUC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 64 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8C1E3 _struct_ref_seq.db_align_beg 221 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 277 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 64 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2CUC GLY A 1 ? UNP Q8C1E3 ? ? 'cloning artifact' 1 1 1 2CUC SER A 2 ? UNP Q8C1E3 ? ? 'cloning artifact' 2 2 1 2CUC SER A 3 ? UNP Q8C1E3 ? ? 'cloning artifact' 3 3 1 2CUC GLY A 4 ? UNP Q8C1E3 ? ? 'cloning artifact' 4 4 1 2CUC SER A 5 ? UNP Q8C1E3 ? ? 'cloning artifact' 5 5 1 2CUC SER A 6 ? UNP Q8C1E3 ? ? 'cloning artifact' 6 6 1 2CUC GLY A 7 ? UNP Q8C1E3 ? ? 'cloning artifact' 7 7 1 2CUC SER A 65 ? UNP Q8C1E3 ? ? 'cloning artifact' 65 8 1 2CUC GLY A 66 ? UNP Q8C1E3 ? ? 'cloning artifact' 66 9 1 2CUC PRO A 67 ? UNP Q8C1E3 ? ? 'cloning artifact' 67 10 1 2CUC SER A 68 ? UNP Q8C1E3 ? ? 'cloning artifact' 68 11 1 2CUC SER A 69 ? UNP Q8C1E3 ? ? 'cloning artifact' 69 12 1 2CUC GLY A 70 ? UNP Q8C1E3 ? ? 'cloning artifact' 70 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '2.01mM protein U-15N,13C; 20mM d-TrisHCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 900 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2CUC _pdbx_nmr_refine.method 'torsion angle dynamics, restrainted molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2CUC _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function,structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2CUC _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, J. A.' 3 'data analysis' KUJIRA 0.9295 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2CUC _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2CUC _struct.title 'Solution structure of the SH3 domain of the mouse hypothetical protein SH3RF2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CUC _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text ;SH3 domain, structural genomics, ring finger 2 containing protein, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 58 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id TYR _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 60 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 58 _struct_conf.end_auth_comp_id TYR _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 60 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 53 ? PRO A 57 ? THR A 53 PRO A 57 A 2 TRP A 42 ? SER A 47 ? TRP A 42 SER A 47 A 3 GLY A 31 ? GLN A 39 ? GLY A 31 GLN A 39 A 4 PHE A 10 ? VAL A 11 ? PHE A 10 VAL A 11 A 5 VAL A 61 ? PRO A 63 ? VAL A 61 PRO A 63 # _database_PDB_matrix.entry_id 2CUC _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2CUC _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 TRP 42 42 42 TRP TRP A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLY 70 70 70 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-26 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_database_remark.id _pdbx_database_remark.text 650 ;HELIX DETERMINATION METHOD: AUTHOR DETERMINED ; 700 ;SHEET DETERMINATION METHOD: AUTHOR DETERMINED ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 18 ? ? -37.73 131.67 2 1 PRO A 21 ? ? -69.69 2.82 3 1 LYS A 28 ? ? -47.89 103.68 4 1 LEU A 35 ? ? -98.24 -70.02 5 1 ASP A 40 ? ? -58.17 102.43 6 1 LEU A 49 ? ? -90.99 -69.57 7 2 SER A 6 ? ? -49.53 99.55 8 2 PRO A 21 ? ? -69.77 1.05 9 2 LYS A 28 ? ? -36.49 109.44 10 2 LEU A 35 ? ? -98.57 -69.82 11 2 ASP A 40 ? ? -53.24 102.15 12 2 SER A 69 ? ? -36.77 131.62 13 3 SER A 3 ? ? -35.89 101.55 14 3 PRO A 21 ? ? -69.77 1.38 15 3 LYS A 28 ? ? -41.03 106.92 16 3 LEU A 35 ? ? -101.52 -69.40 17 3 ASP A 40 ? ? -51.79 102.63 18 4 ALA A 18 ? ? -37.96 125.86 19 4 PRO A 21 ? ? -69.80 2.93 20 4 LYS A 28 ? ? -41.12 102.09 21 4 LEU A 35 ? ? -102.33 -69.73 22 4 ASP A 40 ? ? -55.57 102.25 23 4 SER A 47 ? ? -57.47 109.08 24 4 LEU A 49 ? ? -81.17 -71.73 25 4 SER A 65 ? ? -97.34 40.54 26 4 PRO A 67 ? ? -69.76 -178.51 27 5 SER A 3 ? ? -106.65 41.99 28 5 ALA A 18 ? ? -35.00 133.38 29 5 PRO A 21 ? ? -69.75 2.87 30 5 LYS A 28 ? ? -48.21 96.80 31 5 LEU A 35 ? ? -101.17 -69.95 32 5 ASP A 40 ? ? -53.89 101.93 33 5 SER A 47 ? ? -55.27 109.35 34 6 SER A 2 ? ? -37.93 109.40 35 6 SER A 6 ? ? -36.70 114.36 36 6 PRO A 21 ? ? -69.74 2.95 37 6 LYS A 28 ? ? -46.75 96.40 38 6 LEU A 35 ? ? -99.41 -68.11 39 6 ASP A 40 ? ? -52.59 101.99 40 7 ALA A 18 ? ? -39.11 131.17 41 7 PRO A 21 ? ? -69.79 2.94 42 7 LYS A 28 ? ? -46.73 107.53 43 7 LEU A 35 ? ? -98.67 -66.37 44 7 ASP A 40 ? ? -56.28 102.27 45 8 ALA A 18 ? ? -38.34 132.33 46 8 PRO A 21 ? ? -69.79 2.77 47 8 LEU A 35 ? ? -101.56 -67.46 48 8 ASP A 40 ? ? -55.74 102.32 49 9 SER A 6 ? ? -58.16 96.29 50 9 LYS A 28 ? ? -36.42 104.64 51 9 LEU A 35 ? ? -100.46 -69.78 52 9 ASP A 40 ? ? -52.22 101.98 53 10 PRO A 21 ? ? -69.77 0.60 54 10 LYS A 28 ? ? -37.21 100.33 55 10 LEU A 35 ? ? -103.08 -69.72 56 10 ASP A 40 ? ? -57.58 102.02 57 10 SER A 47 ? ? -55.70 102.07 58 10 LEU A 49 ? ? -81.31 -72.03 59 11 PRO A 21 ? ? -69.78 2.93 60 11 LYS A 28 ? ? -37.60 100.08 61 11 LEU A 35 ? ? -99.64 -69.94 62 11 PRO A 67 ? ? -69.74 82.21 63 11 SER A 68 ? ? -63.13 80.07 64 12 ALA A 18 ? ? -39.46 130.99 65 12 PRO A 21 ? ? -69.74 3.03 66 12 LYS A 28 ? ? -39.24 106.34 67 12 LEU A 35 ? ? -101.90 -69.81 68 12 ASP A 40 ? ? -55.24 102.00 69 13 SER A 6 ? ? -39.55 127.61 70 13 PRO A 21 ? ? -69.80 2.98 71 13 LYS A 28 ? ? -40.29 104.86 72 13 LEU A 35 ? ? -104.79 -69.79 73 13 ASP A 40 ? ? -51.75 101.99 74 13 SER A 69 ? ? -50.59 106.59 75 14 SER A 5 ? ? -36.49 107.78 76 14 ALA A 12 ? ? -99.75 -70.43 77 14 PRO A 21 ? ? -69.78 2.61 78 14 LYS A 28 ? ? -34.61 111.57 79 14 LEU A 35 ? ? -99.80 -69.75 80 14 ASP A 40 ? ? -50.31 102.03 81 15 ALA A 18 ? ? -36.64 129.58 82 15 PRO A 21 ? ? -69.72 2.01 83 15 LYS A 28 ? ? -46.17 102.43 84 15 LEU A 35 ? ? -97.69 -69.47 85 15 ASP A 40 ? ? -52.01 102.31 86 15 SER A 47 ? ? -56.26 106.71 87 16 SER A 5 ? ? -122.11 -50.47 88 16 SER A 6 ? ? -59.60 172.14 89 16 PRO A 21 ? ? -69.76 3.03 90 16 LYS A 28 ? ? -38.40 105.57 91 16 LEU A 35 ? ? -103.84 -69.89 92 16 ASP A 40 ? ? -50.47 102.05 93 17 ALA A 12 ? ? -100.88 -69.29 94 17 ALA A 18 ? ? -39.12 129.99 95 17 PRO A 21 ? ? -69.74 1.22 96 17 LYS A 28 ? ? -42.23 102.68 97 17 LEU A 35 ? ? -103.41 -70.10 98 17 ASP A 40 ? ? -53.58 101.96 99 18 LYS A 28 ? ? -52.58 105.44 100 18 LEU A 35 ? ? -97.49 -70.07 101 18 ASP A 40 ? ? -50.80 101.90 102 18 PRO A 67 ? ? -69.75 99.40 103 18 SER A 68 ? ? -41.22 105.82 104 19 PRO A 21 ? ? -69.73 1.00 105 19 LYS A 28 ? ? -46.16 102.90 106 19 LEU A 35 ? ? -101.58 -69.92 107 19 ASP A 40 ? ? -54.06 102.02 108 20 SER A 2 ? ? -129.13 -52.34 109 20 SER A 5 ? ? -128.39 -50.71 110 20 ALA A 18 ? ? -36.35 129.81 111 20 PRO A 21 ? ? -69.77 2.69 112 20 LYS A 28 ? ? -47.01 99.47 113 20 LEU A 35 ? ? -101.80 -69.62 114 20 ASP A 40 ? ? -50.66 102.07 #