data_2CUD # _entry.id 2CUD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2CUD pdb_00002cud 10.2210/pdb2cud/pdb RCSB RCSB024628 ? ? WWPDB D_1000024628 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-26 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CUD _pdbx_database_status.recvd_initial_deposition_date 2005-05-26 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002007132.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ohnishi, S.' 1 'Kigawa, T.' 2 'Tochio, N.' 3 'Sato, M.' 4 'Nameki, N.' 5 'Koshiba, S.' 6 'Inoue, M.' 7 'Yokoyama, S.' 8 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 9 # _citation.id primary _citation.title 'Solution structure of the SH3 domain of the human SRC-like adopter protein (SLAP)' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ohnishi, S.' 1 ? primary 'Kigawa, T.' 2 ? primary 'Tochio, N.' 3 ? primary 'Sato, M.' 4 ? primary 'Nameki, N.' 5 ? primary 'Koshiba, S.' 6 ? primary 'Inoue, M.' 7 ? primary 'Yokoyama, S.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description SRC-like-adapter _entity.formula_weight 8241.121 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SH3 domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Src-like-adapter protein 1, hSLAP, Slap' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGPLPNPEGLDSDFLAVLSDYPSPDISPPIFRRGEKLRVISDEGGWWKAISLSTGRESYIPGICVARVSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGPLPNPEGLDSDFLAVLSDYPSPDISPPIFRRGEKLRVISDEGGWWKAISLSTGRESYIPGICVARVSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002007132.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 PRO n 1 9 LEU n 1 10 PRO n 1 11 ASN n 1 12 PRO n 1 13 GLU n 1 14 GLY n 1 15 LEU n 1 16 ASP n 1 17 SER n 1 18 ASP n 1 19 PHE n 1 20 LEU n 1 21 ALA n 1 22 VAL n 1 23 LEU n 1 24 SER n 1 25 ASP n 1 26 TYR n 1 27 PRO n 1 28 SER n 1 29 PRO n 1 30 ASP n 1 31 ILE n 1 32 SER n 1 33 PRO n 1 34 PRO n 1 35 ILE n 1 36 PHE n 1 37 ARG n 1 38 ARG n 1 39 GLY n 1 40 GLU n 1 41 LYS n 1 42 LEU n 1 43 ARG n 1 44 VAL n 1 45 ILE n 1 46 SER n 1 47 ASP n 1 48 GLU n 1 49 GLY n 1 50 GLY n 1 51 TRP n 1 52 TRP n 1 53 LYS n 1 54 ALA n 1 55 ILE n 1 56 SER n 1 57 LEU n 1 58 SER n 1 59 THR n 1 60 GLY n 1 61 ARG n 1 62 GLU n 1 63 SER n 1 64 TYR n 1 65 ILE n 1 66 PRO n 1 67 GLY n 1 68 ILE n 1 69 CYS n 1 70 VAL n 1 71 ALA n 1 72 ARG n 1 73 VAL n 1 74 SER n 1 75 GLY n 1 76 PRO n 1 77 SER n 1 78 SER n 1 79 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene SLA _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P040921-09 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 TRP 51 51 51 TRP TRP A . n A 1 52 TRP 52 52 52 TRP TRP A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 CYS 69 69 69 CYS CYS A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 GLY 79 79 79 GLY GLY A . n # _exptl.entry_id 2CUD _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2CUD _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2CUD _struct.title 'Solution structure of the SH3 domain of the human SRC-like adopter protein (SLAP)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CUD _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text ;SH3 domain, Src-like adapter protein (Slap), negative mitogenesis regulator, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SLAP1_HUMAN _struct_ref.pdbx_db_accession Q13239 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code PLPNPEGLDSDFLAVLSDYPSPDISPPIFRRGEKLRVISDEGGWWKAISLSTGRESYIPGICVARV _struct_ref.pdbx_align_begin 14 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CUD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 73 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q13239 _struct_ref_seq.db_align_beg 14 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 79 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 73 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2CUD GLY A 1 ? UNP Q13239 ? ? 'cloning artifact' 1 1 1 2CUD SER A 2 ? UNP Q13239 ? ? 'cloning artifact' 2 2 1 2CUD SER A 3 ? UNP Q13239 ? ? 'cloning artifact' 3 3 1 2CUD GLY A 4 ? UNP Q13239 ? ? 'cloning artifact' 4 4 1 2CUD SER A 5 ? UNP Q13239 ? ? 'cloning artifact' 5 5 1 2CUD SER A 6 ? UNP Q13239 ? ? 'cloning artifact' 6 6 1 2CUD GLY A 7 ? UNP Q13239 ? ? 'cloning artifact' 7 7 1 2CUD SER A 74 ? UNP Q13239 ? ? 'cloning artifact' 74 8 1 2CUD GLY A 75 ? UNP Q13239 ? ? 'cloning artifact' 75 9 1 2CUD PRO A 76 ? UNP Q13239 ? ? 'cloning artifact' 76 10 1 2CUD SER A 77 ? UNP Q13239 ? ? 'cloning artifact' 77 11 1 2CUD SER A 78 ? UNP Q13239 ? ? 'cloning artifact' 78 12 1 2CUD GLY A 79 ? UNP Q13239 ? ? 'cloning artifact' 79 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id GLY _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 67 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id CYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 69 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLY _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 67 _struct_conf.end_auth_comp_id CYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 69 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 26 A . ? TYR 26 A PRO 27 A ? PRO 27 A 1 -0.06 2 TYR 26 A . ? TYR 26 A PRO 27 A ? PRO 27 A 2 -0.07 3 TYR 26 A . ? TYR 26 A PRO 27 A ? PRO 27 A 3 -0.05 4 TYR 26 A . ? TYR 26 A PRO 27 A ? PRO 27 A 4 0.02 5 TYR 26 A . ? TYR 26 A PRO 27 A ? PRO 27 A 5 0.00 6 TYR 26 A . ? TYR 26 A PRO 27 A ? PRO 27 A 6 -0.04 7 TYR 26 A . ? TYR 26 A PRO 27 A ? PRO 27 A 7 -0.07 8 TYR 26 A . ? TYR 26 A PRO 27 A ? PRO 27 A 8 -0.05 9 TYR 26 A . ? TYR 26 A PRO 27 A ? PRO 27 A 9 -0.05 10 TYR 26 A . ? TYR 26 A PRO 27 A ? PRO 27 A 10 0.02 11 TYR 26 A . ? TYR 26 A PRO 27 A ? PRO 27 A 11 -0.02 12 TYR 26 A . ? TYR 26 A PRO 27 A ? PRO 27 A 12 -0.06 13 TYR 26 A . ? TYR 26 A PRO 27 A ? PRO 27 A 13 -0.11 14 TYR 26 A . ? TYR 26 A PRO 27 A ? PRO 27 A 14 -0.06 15 TYR 26 A . ? TYR 26 A PRO 27 A ? PRO 27 A 15 -0.10 16 TYR 26 A . ? TYR 26 A PRO 27 A ? PRO 27 A 16 -0.05 17 TYR 26 A . ? TYR 26 A PRO 27 A ? PRO 27 A 17 -0.04 18 TYR 26 A . ? TYR 26 A PRO 27 A ? PRO 27 A 18 -0.01 19 TYR 26 A . ? TYR 26 A PRO 27 A ? PRO 27 A 19 -0.08 20 TYR 26 A . ? TYR 26 A PRO 27 A ? PRO 27 A 20 -0.03 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 62 ? PRO A 66 ? GLU A 62 PRO A 66 A 2 TRP A 51 ? SER A 56 ? TRP A 51 SER A 56 A 3 LYS A 41 ? GLU A 48 ? LYS A 41 GLU A 48 A 4 PHE A 19 ? VAL A 22 ? PHE A 19 VAL A 22 A 5 VAL A 70 ? VAL A 73 ? VAL A 70 VAL A 73 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O SER A 63 ? O SER A 63 N ALA A 54 ? N ALA A 54 A 2 3 O LYS A 53 ? O LYS A 53 N ILE A 45 ? N ILE A 45 A 3 4 O LEU A 42 ? O LEU A 42 N LEU A 20 ? N LEU A 20 A 4 5 N ALA A 21 ? N ALA A 21 O ALA A 71 ? O ALA A 71 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 11 ? ? -38.31 144.84 2 1 GLU A 13 ? ? 35.48 41.28 3 1 ASP A 25 ? ? -35.97 140.07 4 1 PRO A 27 ? ? -69.75 -173.57 5 1 PRO A 29 ? ? -69.74 3.33 6 1 PRO A 76 ? ? -69.67 -175.66 7 2 PRO A 8 ? ? -69.70 -176.65 8 2 ASN A 11 ? ? -175.02 148.42 9 2 PRO A 29 ? ? -69.70 5.24 10 2 ILE A 31 ? ? -125.56 -53.57 11 2 PRO A 76 ? ? -69.76 2.78 12 2 SER A 77 ? ? -34.90 134.88 13 3 PRO A 8 ? ? -69.75 -174.51 14 3 PRO A 10 ? ? -69.77 1.95 15 3 ASN A 11 ? ? -34.64 135.56 16 3 PRO A 12 ? ? -69.85 1.67 17 3 GLU A 13 ? ? -47.14 101.63 18 3 VAL A 22 ? ? -55.68 106.98 19 3 PRO A 27 ? ? -69.76 -175.48 20 3 PRO A 29 ? ? -69.73 2.92 21 3 PRO A 76 ? ? -69.79 1.27 22 3 SER A 78 ? ? -37.06 124.91 23 4 SER A 2 ? ? 38.36 41.86 24 4 SER A 6 ? ? -37.79 -38.91 25 4 GLU A 13 ? ? -87.96 49.35 26 4 ASP A 25 ? ? -35.37 148.34 27 4 PRO A 27 ? ? -69.80 -174.27 28 4 PRO A 29 ? ? -69.78 3.04 29 5 PRO A 10 ? ? -69.82 80.02 30 5 ASN A 11 ? ? -49.07 109.99 31 5 GLU A 13 ? ? -85.25 33.84 32 5 VAL A 22 ? ? -61.63 99.21 33 5 PRO A 27 ? ? -69.76 -175.09 34 5 PRO A 29 ? ? -69.74 1.14 35 6 PRO A 10 ? ? -69.80 3.00 36 6 ASN A 11 ? ? -33.32 143.21 37 6 PRO A 12 ? ? -69.67 2.50 38 6 GLU A 13 ? ? -50.65 87.05 39 6 ASP A 25 ? ? -36.36 144.55 40 6 PRO A 29 ? ? -69.78 2.86 41 6 ARG A 72 ? ? -67.12 99.01 42 6 PRO A 76 ? ? -69.78 -178.16 43 7 PRO A 10 ? ? -69.68 80.10 44 7 PRO A 12 ? ? -69.80 0.24 45 7 ASP A 25 ? ? -34.99 139.96 46 7 PRO A 27 ? ? -69.74 -174.67 47 7 PRO A 29 ? ? -69.73 5.15 48 7 ARG A 37 ? ? -49.77 156.55 49 7 SER A 77 ? ? -125.94 -55.66 50 8 ASP A 16 ? ? -64.35 -179.47 51 8 VAL A 22 ? ? -57.27 99.97 52 8 PRO A 27 ? ? -69.75 -174.69 53 8 PRO A 29 ? ? -69.76 3.52 54 8 SER A 74 ? ? -35.06 137.08 55 9 PRO A 8 ? ? -69.82 -174.93 56 9 PRO A 10 ? ? -69.83 2.39 57 9 PRO A 12 ? ? -69.80 2.88 58 9 GLU A 13 ? ? -34.57 116.45 59 9 VAL A 22 ? ? -65.04 98.60 60 9 PRO A 27 ? ? -69.75 -175.28 61 9 PRO A 29 ? ? -69.80 3.57 62 9 PRO A 76 ? ? -69.77 0.91 63 9 SER A 77 ? ? -35.04 132.71 64 10 SER A 3 ? ? -171.79 112.89 65 10 PRO A 8 ? ? -69.75 -168.23 66 10 ASN A 11 ? ? -34.61 150.19 67 10 PRO A 12 ? ? -69.73 1.63 68 10 GLU A 13 ? ? -100.23 73.69 69 10 VAL A 22 ? ? -55.33 104.75 70 10 ASP A 25 ? ? -39.43 146.55 71 10 PRO A 27 ? ? -69.83 -174.27 72 10 PRO A 29 ? ? -69.69 1.21 73 10 SER A 74 ? ? -107.77 79.40 74 10 SER A 78 ? ? -51.11 106.33 75 11 SER A 3 ? ? -123.93 -53.47 76 11 PRO A 10 ? ? -69.79 2.98 77 11 ASN A 11 ? ? -34.61 144.02 78 11 PRO A 12 ? ? -69.82 1.72 79 11 GLU A 13 ? ? 32.62 48.69 80 11 VAL A 22 ? ? -58.53 100.72 81 11 PRO A 27 ? ? -69.82 -178.67 82 11 PRO A 29 ? ? -69.77 2.46 83 11 PRO A 76 ? ? -69.70 2.29 84 11 SER A 77 ? ? -40.18 154.84 85 12 LEU A 9 ? ? -39.74 153.41 86 12 PRO A 12 ? ? -69.71 1.83 87 12 GLU A 13 ? ? 35.18 31.82 88 12 PRO A 27 ? ? -69.80 -174.52 89 12 PRO A 29 ? ? -69.80 1.63 90 12 ARG A 72 ? ? -61.00 97.72 91 13 SER A 3 ? ? -170.84 120.86 92 13 ASN A 11 ? ? -46.96 159.51 93 13 PRO A 12 ? ? -69.78 0.01 94 13 VAL A 22 ? ? -59.11 96.67 95 13 PRO A 27 ? ? -69.71 -173.98 96 13 PRO A 29 ? ? -69.81 3.44 97 13 SER A 74 ? ? -99.40 41.69 98 13 SER A 78 ? ? -108.40 41.51 99 14 SER A 5 ? ? -101.97 -60.14 100 14 PRO A 10 ? ? -69.80 79.96 101 14 VAL A 22 ? ? -58.86 103.62 102 14 ASP A 25 ? ? -37.03 149.38 103 14 PRO A 27 ? ? -69.76 -175.30 104 14 PRO A 29 ? ? -69.71 3.42 105 14 PRO A 76 ? ? -69.86 90.27 106 14 SER A 77 ? ? -107.28 40.83 107 15 SER A 2 ? ? -46.29 171.26 108 15 ASN A 11 ? ? -34.52 150.67 109 15 PRO A 12 ? ? -69.79 0.63 110 15 GLU A 13 ? ? -34.98 94.26 111 15 VAL A 22 ? ? -66.85 97.37 112 15 ASP A 25 ? ? -39.10 149.06 113 15 PRO A 27 ? ? -69.70 -174.70 114 15 PRO A 29 ? ? -69.81 3.52 115 16 SER A 2 ? ? -162.23 116.39 116 16 VAL A 22 ? ? -63.20 96.25 117 16 ASP A 25 ? ? -38.79 143.48 118 16 PRO A 29 ? ? -69.77 5.28 119 16 PRO A 76 ? ? -69.75 89.20 120 17 PRO A 10 ? ? -69.77 2.48 121 17 ASN A 11 ? ? -34.34 143.29 122 17 GLU A 13 ? ? -39.05 93.35 123 17 PRO A 27 ? ? -69.81 -174.12 124 17 PRO A 29 ? ? -69.78 2.78 125 18 LEU A 9 ? ? -47.25 157.66 126 18 PRO A 10 ? ? -69.74 2.06 127 18 ASN A 11 ? ? -34.46 143.96 128 18 PRO A 12 ? ? -69.76 2.53 129 18 GLU A 13 ? ? -47.06 91.00 130 18 VAL A 22 ? ? -54.92 103.65 131 18 SER A 24 ? ? -160.33 118.79 132 18 ASP A 25 ? ? -34.28 140.19 133 18 PRO A 29 ? ? -69.74 4.05 134 18 ILE A 31 ? ? -120.53 -60.60 135 18 PRO A 76 ? ? -69.80 -174.93 136 19 PRO A 10 ? ? -69.76 79.70 137 19 PRO A 12 ? ? -69.80 1.15 138 19 PRO A 27 ? ? -69.76 -174.36 139 19 PRO A 29 ? ? -69.80 3.17 140 19 SER A 74 ? ? -37.61 149.58 141 19 PRO A 76 ? ? -69.76 91.75 142 19 SER A 78 ? ? -45.98 151.44 143 20 SER A 5 ? ? -103.05 43.29 144 20 PRO A 12 ? ? -69.74 2.14 145 20 GLU A 13 ? ? -55.00 96.46 146 20 VAL A 22 ? ? -60.09 97.07 147 20 PRO A 27 ? ? -69.76 -177.42 148 20 PRO A 29 ? ? -69.77 4.00 149 20 ARG A 38 ? ? -37.51 144.99 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX DETERMINATION METHOD: AUTHOR DETERMINED ; # _pdbx_nmr_ensemble.entry_id 2CUD _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function,structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2CUD _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.28mM protein U-15N,13C; 20mM d-TrisHCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_refine.entry_id 2CUD _pdbx_nmr_refine.method 'torsion angle dynamics, restrained molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0,4 'Johnson, B. A.' 3 'data analysis' KUJIRA 0.9295 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLU N N N N 88 GLU CA C N S 89 GLU C C N N 90 GLU O O N N 91 GLU CB C N N 92 GLU CG C N N 93 GLU CD C N N 94 GLU OE1 O N N 95 GLU OE2 O N N 96 GLU OXT O N N 97 GLU H H N N 98 GLU H2 H N N 99 GLU HA H N N 100 GLU HB2 H N N 101 GLU HB3 H N N 102 GLU HG2 H N N 103 GLU HG3 H N N 104 GLU HE2 H N N 105 GLU HXT H N N 106 GLY N N N N 107 GLY CA C N N 108 GLY C C N N 109 GLY O O N N 110 GLY OXT O N N 111 GLY H H N N 112 GLY H2 H N N 113 GLY HA2 H N N 114 GLY HA3 H N N 115 GLY HXT H N N 116 ILE N N N N 117 ILE CA C N S 118 ILE C C N N 119 ILE O O N N 120 ILE CB C N S 121 ILE CG1 C N N 122 ILE CG2 C N N 123 ILE CD1 C N N 124 ILE OXT O N N 125 ILE H H N N 126 ILE H2 H N N 127 ILE HA H N N 128 ILE HB H N N 129 ILE HG12 H N N 130 ILE HG13 H N N 131 ILE HG21 H N N 132 ILE HG22 H N N 133 ILE HG23 H N N 134 ILE HD11 H N N 135 ILE HD12 H N N 136 ILE HD13 H N N 137 ILE HXT H N N 138 LEU N N N N 139 LEU CA C N S 140 LEU C C N N 141 LEU O O N N 142 LEU CB C N N 143 LEU CG C N N 144 LEU CD1 C N N 145 LEU CD2 C N N 146 LEU OXT O N N 147 LEU H H N N 148 LEU H2 H N N 149 LEU HA H N N 150 LEU HB2 H N N 151 LEU HB3 H N N 152 LEU HG H N N 153 LEU HD11 H N N 154 LEU HD12 H N N 155 LEU HD13 H N N 156 LEU HD21 H N N 157 LEU HD22 H N N 158 LEU HD23 H N N 159 LEU HXT H N N 160 LYS N N N N 161 LYS CA C N S 162 LYS C C N N 163 LYS O O N N 164 LYS CB C N N 165 LYS CG C N N 166 LYS CD C N N 167 LYS CE C N N 168 LYS NZ N N N 169 LYS OXT O N N 170 LYS H H N N 171 LYS H2 H N N 172 LYS HA H N N 173 LYS HB2 H N N 174 LYS HB3 H N N 175 LYS HG2 H N N 176 LYS HG3 H N N 177 LYS HD2 H N N 178 LYS HD3 H N N 179 LYS HE2 H N N 180 LYS HE3 H N N 181 LYS HZ1 H N N 182 LYS HZ2 H N N 183 LYS HZ3 H N N 184 LYS HXT H N N 185 PHE N N N N 186 PHE CA C N S 187 PHE C C N N 188 PHE O O N N 189 PHE CB C N N 190 PHE CG C Y N 191 PHE CD1 C Y N 192 PHE CD2 C Y N 193 PHE CE1 C Y N 194 PHE CE2 C Y N 195 PHE CZ C Y N 196 PHE OXT O N N 197 PHE H H N N 198 PHE H2 H N N 199 PHE HA H N N 200 PHE HB2 H N N 201 PHE HB3 H N N 202 PHE HD1 H N N 203 PHE HD2 H N N 204 PHE HE1 H N N 205 PHE HE2 H N N 206 PHE HZ H N N 207 PHE HXT H N N 208 PRO N N N N 209 PRO CA C N S 210 PRO C C N N 211 PRO O O N N 212 PRO CB C N N 213 PRO CG C N N 214 PRO CD C N N 215 PRO OXT O N N 216 PRO H H N N 217 PRO HA H N N 218 PRO HB2 H N N 219 PRO HB3 H N N 220 PRO HG2 H N N 221 PRO HG3 H N N 222 PRO HD2 H N N 223 PRO HD3 H N N 224 PRO HXT H N N 225 SER N N N N 226 SER CA C N S 227 SER C C N N 228 SER O O N N 229 SER CB C N N 230 SER OG O N N 231 SER OXT O N N 232 SER H H N N 233 SER H2 H N N 234 SER HA H N N 235 SER HB2 H N N 236 SER HB3 H N N 237 SER HG H N N 238 SER HXT H N N 239 THR N N N N 240 THR CA C N S 241 THR C C N N 242 THR O O N N 243 THR CB C N R 244 THR OG1 O N N 245 THR CG2 C N N 246 THR OXT O N N 247 THR H H N N 248 THR H2 H N N 249 THR HA H N N 250 THR HB H N N 251 THR HG1 H N N 252 THR HG21 H N N 253 THR HG22 H N N 254 THR HG23 H N N 255 THR HXT H N N 256 TRP N N N N 257 TRP CA C N S 258 TRP C C N N 259 TRP O O N N 260 TRP CB C N N 261 TRP CG C Y N 262 TRP CD1 C Y N 263 TRP CD2 C Y N 264 TRP NE1 N Y N 265 TRP CE2 C Y N 266 TRP CE3 C Y N 267 TRP CZ2 C Y N 268 TRP CZ3 C Y N 269 TRP CH2 C Y N 270 TRP OXT O N N 271 TRP H H N N 272 TRP H2 H N N 273 TRP HA H N N 274 TRP HB2 H N N 275 TRP HB3 H N N 276 TRP HD1 H N N 277 TRP HE1 H N N 278 TRP HE3 H N N 279 TRP HZ2 H N N 280 TRP HZ3 H N N 281 TRP HH2 H N N 282 TRP HXT H N N 283 TYR N N N N 284 TYR CA C N S 285 TYR C C N N 286 TYR O O N N 287 TYR CB C N N 288 TYR CG C Y N 289 TYR CD1 C Y N 290 TYR CD2 C Y N 291 TYR CE1 C Y N 292 TYR CE2 C Y N 293 TYR CZ C Y N 294 TYR OH O N N 295 TYR OXT O N N 296 TYR H H N N 297 TYR H2 H N N 298 TYR HA H N N 299 TYR HB2 H N N 300 TYR HB3 H N N 301 TYR HD1 H N N 302 TYR HD2 H N N 303 TYR HE1 H N N 304 TYR HE2 H N N 305 TYR HH H N N 306 TYR HXT H N N 307 VAL N N N N 308 VAL CA C N S 309 VAL C C N N 310 VAL O O N N 311 VAL CB C N N 312 VAL CG1 C N N 313 VAL CG2 C N N 314 VAL OXT O N N 315 VAL H H N N 316 VAL H2 H N N 317 VAL HA H N N 318 VAL HB H N N 319 VAL HG11 H N N 320 VAL HG12 H N N 321 VAL HG13 H N N 322 VAL HG21 H N N 323 VAL HG22 H N N 324 VAL HG23 H N N 325 VAL HXT H N N 326 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLU N CA sing N N 83 GLU N H sing N N 84 GLU N H2 sing N N 85 GLU CA C sing N N 86 GLU CA CB sing N N 87 GLU CA HA sing N N 88 GLU C O doub N N 89 GLU C OXT sing N N 90 GLU CB CG sing N N 91 GLU CB HB2 sing N N 92 GLU CB HB3 sing N N 93 GLU CG CD sing N N 94 GLU CG HG2 sing N N 95 GLU CG HG3 sing N N 96 GLU CD OE1 doub N N 97 GLU CD OE2 sing N N 98 GLU OE2 HE2 sing N N 99 GLU OXT HXT sing N N 100 GLY N CA sing N N 101 GLY N H sing N N 102 GLY N H2 sing N N 103 GLY CA C sing N N 104 GLY CA HA2 sing N N 105 GLY CA HA3 sing N N 106 GLY C O doub N N 107 GLY C OXT sing N N 108 GLY OXT HXT sing N N 109 ILE N CA sing N N 110 ILE N H sing N N 111 ILE N H2 sing N N 112 ILE CA C sing N N 113 ILE CA CB sing N N 114 ILE CA HA sing N N 115 ILE C O doub N N 116 ILE C OXT sing N N 117 ILE CB CG1 sing N N 118 ILE CB CG2 sing N N 119 ILE CB HB sing N N 120 ILE CG1 CD1 sing N N 121 ILE CG1 HG12 sing N N 122 ILE CG1 HG13 sing N N 123 ILE CG2 HG21 sing N N 124 ILE CG2 HG22 sing N N 125 ILE CG2 HG23 sing N N 126 ILE CD1 HD11 sing N N 127 ILE CD1 HD12 sing N N 128 ILE CD1 HD13 sing N N 129 ILE OXT HXT sing N N 130 LEU N CA sing N N 131 LEU N H sing N N 132 LEU N H2 sing N N 133 LEU CA C sing N N 134 LEU CA CB sing N N 135 LEU CA HA sing N N 136 LEU C O doub N N 137 LEU C OXT sing N N 138 LEU CB CG sing N N 139 LEU CB HB2 sing N N 140 LEU CB HB3 sing N N 141 LEU CG CD1 sing N N 142 LEU CG CD2 sing N N 143 LEU CG HG sing N N 144 LEU CD1 HD11 sing N N 145 LEU CD1 HD12 sing N N 146 LEU CD1 HD13 sing N N 147 LEU CD2 HD21 sing N N 148 LEU CD2 HD22 sing N N 149 LEU CD2 HD23 sing N N 150 LEU OXT HXT sing N N 151 LYS N CA sing N N 152 LYS N H sing N N 153 LYS N H2 sing N N 154 LYS CA C sing N N 155 LYS CA CB sing N N 156 LYS CA HA sing N N 157 LYS C O doub N N 158 LYS C OXT sing N N 159 LYS CB CG sing N N 160 LYS CB HB2 sing N N 161 LYS CB HB3 sing N N 162 LYS CG CD sing N N 163 LYS CG HG2 sing N N 164 LYS CG HG3 sing N N 165 LYS CD CE sing N N 166 LYS CD HD2 sing N N 167 LYS CD HD3 sing N N 168 LYS CE NZ sing N N 169 LYS CE HE2 sing N N 170 LYS CE HE3 sing N N 171 LYS NZ HZ1 sing N N 172 LYS NZ HZ2 sing N N 173 LYS NZ HZ3 sing N N 174 LYS OXT HXT sing N N 175 PHE N CA sing N N 176 PHE N H sing N N 177 PHE N H2 sing N N 178 PHE CA C sing N N 179 PHE CA CB sing N N 180 PHE CA HA sing N N 181 PHE C O doub N N 182 PHE C OXT sing N N 183 PHE CB CG sing N N 184 PHE CB HB2 sing N N 185 PHE CB HB3 sing N N 186 PHE CG CD1 doub Y N 187 PHE CG CD2 sing Y N 188 PHE CD1 CE1 sing Y N 189 PHE CD1 HD1 sing N N 190 PHE CD2 CE2 doub Y N 191 PHE CD2 HD2 sing N N 192 PHE CE1 CZ doub Y N 193 PHE CE1 HE1 sing N N 194 PHE CE2 CZ sing Y N 195 PHE CE2 HE2 sing N N 196 PHE CZ HZ sing N N 197 PHE OXT HXT sing N N 198 PRO N CA sing N N 199 PRO N CD sing N N 200 PRO N H sing N N 201 PRO CA C sing N N 202 PRO CA CB sing N N 203 PRO CA HA sing N N 204 PRO C O doub N N 205 PRO C OXT sing N N 206 PRO CB CG sing N N 207 PRO CB HB2 sing N N 208 PRO CB HB3 sing N N 209 PRO CG CD sing N N 210 PRO CG HG2 sing N N 211 PRO CG HG3 sing N N 212 PRO CD HD2 sing N N 213 PRO CD HD3 sing N N 214 PRO OXT HXT sing N N 215 SER N CA sing N N 216 SER N H sing N N 217 SER N H2 sing N N 218 SER CA C sing N N 219 SER CA CB sing N N 220 SER CA HA sing N N 221 SER C O doub N N 222 SER C OXT sing N N 223 SER CB OG sing N N 224 SER CB HB2 sing N N 225 SER CB HB3 sing N N 226 SER OG HG sing N N 227 SER OXT HXT sing N N 228 THR N CA sing N N 229 THR N H sing N N 230 THR N H2 sing N N 231 THR CA C sing N N 232 THR CA CB sing N N 233 THR CA HA sing N N 234 THR C O doub N N 235 THR C OXT sing N N 236 THR CB OG1 sing N N 237 THR CB CG2 sing N N 238 THR CB HB sing N N 239 THR OG1 HG1 sing N N 240 THR CG2 HG21 sing N N 241 THR CG2 HG22 sing N N 242 THR CG2 HG23 sing N N 243 THR OXT HXT sing N N 244 TRP N CA sing N N 245 TRP N H sing N N 246 TRP N H2 sing N N 247 TRP CA C sing N N 248 TRP CA CB sing N N 249 TRP CA HA sing N N 250 TRP C O doub N N 251 TRP C OXT sing N N 252 TRP CB CG sing N N 253 TRP CB HB2 sing N N 254 TRP CB HB3 sing N N 255 TRP CG CD1 doub Y N 256 TRP CG CD2 sing Y N 257 TRP CD1 NE1 sing Y N 258 TRP CD1 HD1 sing N N 259 TRP CD2 CE2 doub Y N 260 TRP CD2 CE3 sing Y N 261 TRP NE1 CE2 sing Y N 262 TRP NE1 HE1 sing N N 263 TRP CE2 CZ2 sing Y N 264 TRP CE3 CZ3 doub Y N 265 TRP CE3 HE3 sing N N 266 TRP CZ2 CH2 doub Y N 267 TRP CZ2 HZ2 sing N N 268 TRP CZ3 CH2 sing Y N 269 TRP CZ3 HZ3 sing N N 270 TRP CH2 HH2 sing N N 271 TRP OXT HXT sing N N 272 TYR N CA sing N N 273 TYR N H sing N N 274 TYR N H2 sing N N 275 TYR CA C sing N N 276 TYR CA CB sing N N 277 TYR CA HA sing N N 278 TYR C O doub N N 279 TYR C OXT sing N N 280 TYR CB CG sing N N 281 TYR CB HB2 sing N N 282 TYR CB HB3 sing N N 283 TYR CG CD1 doub Y N 284 TYR CG CD2 sing Y N 285 TYR CD1 CE1 sing Y N 286 TYR CD1 HD1 sing N N 287 TYR CD2 CE2 doub Y N 288 TYR CD2 HD2 sing N N 289 TYR CE1 CZ doub Y N 290 TYR CE1 HE1 sing N N 291 TYR CE2 CZ sing Y N 292 TYR CE2 HE2 sing N N 293 TYR CZ OH sing N N 294 TYR OH HH sing N N 295 TYR OXT HXT sing N N 296 VAL N CA sing N N 297 VAL N H sing N N 298 VAL N H2 sing N N 299 VAL CA C sing N N 300 VAL CA CB sing N N 301 VAL CA HA sing N N 302 VAL C O doub N N 303 VAL C OXT sing N N 304 VAL CB CG1 sing N N 305 VAL CB CG2 sing N N 306 VAL CB HB sing N N 307 VAL CG1 HG11 sing N N 308 VAL CG1 HG12 sing N N 309 VAL CG1 HG13 sing N N 310 VAL CG2 HG21 sing N N 311 VAL CG2 HG22 sing N N 312 VAL CG2 HG23 sing N N 313 VAL OXT HXT sing N N 314 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 900 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2CUD _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_