data_2CUP # _entry.id 2CUP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2CUP pdb_00002cup 10.2210/pdb2cup/pdb RCSB RCSB024640 ? ? WWPDB D_1000024640 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hss001003796.2 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CUP _pdbx_database_status.recvd_initial_deposition_date 2005-05-27 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Niraula, T.N.' 1 'Koshiba, S.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Yokoyama, S.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title 'Solution structure of the Skeletal muscle LIM-protein 1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Niraula, T.N.' 1 ? primary 'Koshiba, S.' 2 ? primary 'Inoue, M.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Yokoyama, S.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Skeletal muscle LIM-protein 1' 11141.685 1 ? ? 'One and a half LIM domain' ? 2 non-polymer syn 'ZINC ION' 65.409 3 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'SLIM 1, SLIM, Four and a half LIM domains protein 1, FHL-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGCVECRKPIGADSKEVHYKNRFWHDTCFRCAKCLHPLANETFVAKDNKILCNKCTTREDSPKCKGCFKAIVAGD QNVEYKGTVWHKDCFSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGCVECRKPIGADSKEVHYKNRFWHDTCFRCAKCLHPLANETFVAKDNKILCNKCTTREDSPKCKGCFKAIVAGD QNVEYKGTVWHKDCFSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hss001003796.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 CYS n 1 9 VAL n 1 10 GLU n 1 11 CYS n 1 12 ARG n 1 13 LYS n 1 14 PRO n 1 15 ILE n 1 16 GLY n 1 17 ALA n 1 18 ASP n 1 19 SER n 1 20 LYS n 1 21 GLU n 1 22 VAL n 1 23 HIS n 1 24 TYR n 1 25 LYS n 1 26 ASN n 1 27 ARG n 1 28 PHE n 1 29 TRP n 1 30 HIS n 1 31 ASP n 1 32 THR n 1 33 CYS n 1 34 PHE n 1 35 ARG n 1 36 CYS n 1 37 ALA n 1 38 LYS n 1 39 CYS n 1 40 LEU n 1 41 HIS n 1 42 PRO n 1 43 LEU n 1 44 ALA n 1 45 ASN n 1 46 GLU n 1 47 THR n 1 48 PHE n 1 49 VAL n 1 50 ALA n 1 51 LYS n 1 52 ASP n 1 53 ASN n 1 54 LYS n 1 55 ILE n 1 56 LEU n 1 57 CYS n 1 58 ASN n 1 59 LYS n 1 60 CYS n 1 61 THR n 1 62 THR n 1 63 ARG n 1 64 GLU n 1 65 ASP n 1 66 SER n 1 67 PRO n 1 68 LYS n 1 69 CYS n 1 70 LYS n 1 71 GLY n 1 72 CYS n 1 73 PHE n 1 74 LYS n 1 75 ALA n 1 76 ILE n 1 77 VAL n 1 78 ALA n 1 79 GLY n 1 80 ASP n 1 81 GLN n 1 82 ASN n 1 83 VAL n 1 84 GLU n 1 85 TYR n 1 86 LYS n 1 87 GLY n 1 88 THR n 1 89 VAL n 1 90 TRP n 1 91 HIS n 1 92 LYS n 1 93 ASP n 1 94 CYS n 1 95 PHE n 1 96 SER n 1 97 GLY n 1 98 PRO n 1 99 SER n 1 100 SER n 1 101 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'FHL 1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 040816-01 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FHL1_HUMAN _struct_ref.pdbx_db_accession Q13642 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;CVECRKPIGADSKEVHYKNRFWHDTCFRCAKCLHPLANETFVAKDNKILCNKCTTREDSPKCKGCFKAIVAGDQNVEYKG TVWHKDCF ; _struct_ref.pdbx_align_begin 39 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CUP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 95 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q13642 _struct_ref_seq.db_align_beg 39 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 126 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 95 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2CUP GLY A 1 ? UNP Q13642 ? ? 'cloning artifact' 1 1 1 2CUP SER A 2 ? UNP Q13642 ? ? 'cloning artifact' 2 2 1 2CUP SER A 3 ? UNP Q13642 ? ? 'cloning artifact' 3 3 1 2CUP GLY A 4 ? UNP Q13642 ? ? 'cloning artifact' 4 4 1 2CUP SER A 5 ? UNP Q13642 ? ? 'cloning artifact' 5 5 1 2CUP SER A 6 ? UNP Q13642 ? ? 'cloning artifact' 6 6 1 2CUP GLY A 7 ? UNP Q13642 ? ? 'cloning artifact' 7 7 1 2CUP SER A 96 ? UNP Q13642 ? ? 'cloning artifact' 96 8 1 2CUP GLY A 97 ? UNP Q13642 ? ? 'cloning artifact' 97 9 1 2CUP PRO A 98 ? UNP Q13642 ? ? 'cloning artifact' 98 10 1 2CUP SER A 99 ? UNP Q13642 ? ? 'cloning artifact' 99 11 1 2CUP SER A 100 ? UNP Q13642 ? ? 'cloning artifact' 100 12 1 2CUP GLY A 101 ? UNP Q13642 ? ? 'cloning artifact' 101 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.40mM protein U-13C 15N; 20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 0.01mM ZnCl2; 90% H2O; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2CUP _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2CUP _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function,structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2CUP _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.913 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2CUP _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2CUP _struct.title 'Solution structure of the Skeletal muscle LIM-protein 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CUP _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text ;Four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id CYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 57 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id THR _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 62 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id CYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 57 _struct_conf.end_auth_comp_id THR _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 62 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 8 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 8 A ZN 201 1_555 ? ? ? ? ? ? ? 2.369 ? ? metalc2 metalc ? ? A CYS 11 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 11 A ZN 201 1_555 ? ? ? ? ? ? ? 2.321 ? ? metalc3 metalc ? ? A HIS 30 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 30 A ZN 201 1_555 ? ? ? ? ? ? ? 2.324 ? ? metalc4 metalc ? ? A CYS 33 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 33 A ZN 201 1_555 ? ? ? ? ? ? ? 2.309 ? ? metalc5 metalc ? ? A CYS 36 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 36 A ZN 401 1_555 ? ? ? ? ? ? ? 2.367 ? ? metalc6 metalc ? ? A CYS 39 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 39 A ZN 401 1_555 ? ? ? ? ? ? ? 2.334 ? ? metalc7 metalc ? ? A CYS 57 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 57 A ZN 401 1_555 ? ? ? ? ? ? ? 2.329 ? ? metalc8 metalc ? ? A CYS 60 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 60 A ZN 401 1_555 ? ? ? ? ? ? ? 2.343 ? ? metalc9 metalc ? ? A CYS 69 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 69 A ZN 601 1_555 ? ? ? ? ? ? ? 2.332 ? ? metalc10 metalc ? ? A CYS 72 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 72 A ZN 601 1_555 ? ? ? ? ? ? ? 2.331 ? ? metalc11 metalc ? ? A HIS 91 ND1 ? ? ? 1_555 D ZN . ZN ? ? A HIS 91 A ZN 601 1_555 ? ? ? ? ? ? ? 2.336 ? ? metalc12 metalc ? ? A CYS 94 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 94 A ZN 601 1_555 ? ? ? ? ? ? ? 2.337 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 21 ? TYR A 24 ? GLU A 21 TYR A 24 A 2 ARG A 27 ? HIS A 30 ? ARG A 27 HIS A 30 B 1 VAL A 49 ? LYS A 51 ? VAL A 49 LYS A 51 B 2 LYS A 54 ? LEU A 56 ? LYS A 54 LEU A 56 C 1 ASN A 82 ? GLU A 84 ? ASN A 82 GLU A 84 C 2 VAL A 89 ? HIS A 91 ? VAL A 89 HIS A 91 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 22 ? N VAL A 22 O TRP A 29 ? O TRP A 29 B 1 2 N VAL A 49 ? N VAL A 49 O LEU A 56 ? O LEU A 56 C 1 2 N VAL A 83 ? N VAL A 83 O TRP A 90 ? O TRP A 90 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' AC3 Software A ZN 601 ? 4 'BINDING SITE FOR RESIDUE ZN A 601' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 8 ? CYS A 8 . ? 1_555 ? 2 AC1 4 CYS A 11 ? CYS A 11 . ? 1_555 ? 3 AC1 4 HIS A 30 ? HIS A 30 . ? 1_555 ? 4 AC1 4 CYS A 33 ? CYS A 33 . ? 1_555 ? 5 AC2 4 CYS A 36 ? CYS A 36 . ? 1_555 ? 6 AC2 4 CYS A 39 ? CYS A 39 . ? 1_555 ? 7 AC2 4 CYS A 57 ? CYS A 57 . ? 1_555 ? 8 AC2 4 CYS A 60 ? CYS A 60 . ? 1_555 ? 9 AC3 4 CYS A 69 ? CYS A 69 . ? 1_555 ? 10 AC3 4 CYS A 72 ? CYS A 72 . ? 1_555 ? 11 AC3 4 HIS A 91 ? HIS A 91 . ? 1_555 ? 12 AC3 4 CYS A 94 ? CYS A 94 . ? 1_555 ? # _database_PDB_matrix.entry_id 2CUP _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2CUP _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 TRP 29 29 29 TRP TRP A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 CYS 57 57 57 CYS CYS A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 CYS 69 69 69 CYS CYS A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 CYS 72 72 72 CYS CYS A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 TRP 90 90 90 TRP TRP A . n A 1 91 HIS 91 91 91 HIS HIS A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 CYS 94 94 94 CYS CYS A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 GLY 101 101 101 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . D 2 ZN 1 601 601 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 8 ? A CYS 8 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 11 ? A CYS 11 ? 1_555 95.5 ? 2 SG ? A CYS 8 ? A CYS 8 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 30 ? A HIS 30 ? 1_555 110.9 ? 3 SG ? A CYS 11 ? A CYS 11 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 30 ? A HIS 30 ? 1_555 87.1 ? 4 SG ? A CYS 8 ? A CYS 8 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 33 ? A CYS 33 ? 1_555 117.6 ? 5 SG ? A CYS 11 ? A CYS 11 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 33 ? A CYS 33 ? 1_555 120.1 ? 6 ND1 ? A HIS 30 ? A HIS 30 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 33 ? A CYS 33 ? 1_555 119.6 ? 7 SG ? A CYS 36 ? A CYS 36 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 39 ? A CYS 39 ? 1_555 102.5 ? 8 SG ? A CYS 36 ? A CYS 36 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 57 ? A CYS 57 ? 1_555 114.9 ? 9 SG ? A CYS 39 ? A CYS 39 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 57 ? A CYS 57 ? 1_555 101.7 ? 10 SG ? A CYS 36 ? A CYS 36 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 60 ? A CYS 60 ? 1_555 115.5 ? 11 SG ? A CYS 39 ? A CYS 39 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 60 ? A CYS 60 ? 1_555 117.3 ? 12 SG ? A CYS 57 ? A CYS 57 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 60 ? A CYS 60 ? 1_555 104.5 ? 13 SG ? A CYS 69 ? A CYS 69 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 SG ? A CYS 72 ? A CYS 72 ? 1_555 108.0 ? 14 SG ? A CYS 69 ? A CYS 69 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 ND1 ? A HIS 91 ? A HIS 91 ? 1_555 106.1 ? 15 SG ? A CYS 72 ? A CYS 72 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 ND1 ? A HIS 91 ? A HIS 91 ? 1_555 86.7 ? 16 SG ? A CYS 69 ? A CYS 69 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 SG ? A CYS 94 ? A CYS 94 ? 1_555 117.0 ? 17 SG ? A CYS 72 ? A CYS 72 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 SG ? A CYS 94 ? A CYS 94 ? 1_555 116.9 ? 18 ND1 ? A HIS 91 ? A HIS 91 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 SG ? A CYS 94 ? A CYS 94 ? 1_555 117.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-27 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 17 4 'Structure model' '_struct_ref_seq_dif.details' 18 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 19 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 20 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 3 ? ? -133.07 -47.61 2 1 PHE A 34 ? ? -59.61 104.98 3 1 THR A 62 ? ? -48.11 175.23 4 1 SER A 66 ? ? -44.25 161.62 5 1 TYR A 85 ? ? -126.34 -77.07 6 1 LYS A 92 ? ? -38.43 -36.93 7 1 SER A 96 ? ? -108.43 78.84 8 1 PRO A 98 ? ? -69.74 2.55 9 2 ARG A 12 ? ? 37.60 32.73 10 2 ARG A 63 ? ? -35.60 128.90 11 2 SER A 66 ? ? -33.95 145.82 12 2 PRO A 67 ? ? -69.70 -179.42 13 2 PHE A 73 ? ? 73.74 51.49 14 2 TYR A 85 ? ? -98.13 -72.02 15 2 LYS A 92 ? ? -36.54 -29.38 16 2 SER A 96 ? ? -123.23 -60.41 17 2 SER A 100 ? ? -35.64 145.40 18 3 ARG A 12 ? ? 46.32 28.53 19 3 ASP A 65 ? ? 39.10 51.06 20 3 PHE A 73 ? ? 71.78 51.41 21 3 LYS A 92 ? ? -36.69 -36.59 22 4 ARG A 12 ? ? 30.99 37.99 23 4 PHE A 34 ? ? -59.39 99.51 24 4 ASP A 65 ? ? -100.68 76.57 25 4 LYS A 92 ? ? -34.45 -31.96 26 4 SER A 96 ? ? -97.73 55.80 27 4 SER A 99 ? ? 37.73 39.26 28 5 SER A 5 ? ? -100.28 -62.75 29 5 SER A 6 ? ? -55.14 102.66 30 5 ARG A 12 ? ? 39.94 37.94 31 5 PHE A 34 ? ? -55.70 98.74 32 5 CYS A 36 ? ? -59.05 172.60 33 5 THR A 61 ? ? -38.08 -31.63 34 5 ARG A 63 ? ? -39.40 115.52 35 5 ASP A 65 ? ? -85.81 39.58 36 5 TYR A 85 ? ? -123.61 -80.80 37 6 SER A 5 ? ? -100.67 44.30 38 6 ASP A 65 ? ? 73.77 44.67 39 6 SER A 66 ? ? -37.48 139.91 40 6 PHE A 73 ? ? 74.22 49.00 41 6 GLN A 81 ? ? -39.79 147.59 42 6 TYR A 85 ? ? -114.24 -77.34 43 6 HIS A 91 ? ? -49.73 158.14 44 6 SER A 99 ? ? -171.77 144.91 45 7 PHE A 34 ? ? -58.48 97.01 46 7 ASP A 65 ? ? -57.83 87.28 47 7 SER A 66 ? ? -37.50 157.27 48 7 PRO A 67 ? ? -69.79 -175.87 49 7 LYS A 92 ? ? -34.74 -31.47 50 8 ARG A 12 ? ? 31.50 42.63 51 8 PHE A 73 ? ? 71.83 43.95 52 8 ASP A 80 ? ? -49.56 172.59 53 8 TYR A 85 ? ? -128.11 -74.87 54 8 HIS A 91 ? ? -39.99 161.46 55 9 PHE A 34 ? ? -56.34 101.53 56 9 THR A 61 ? ? -37.71 -39.94 57 9 ASP A 65 ? ? -69.68 69.40 58 9 PHE A 73 ? ? 75.07 45.96 59 9 SER A 96 ? ? -92.59 46.16 60 10 PHE A 34 ? ? -55.74 107.77 61 10 CYS A 60 ? ? -76.19 -74.04 62 10 LYS A 92 ? ? -32.89 -36.67 63 11 SER A 2 ? ? -84.32 48.74 64 11 SER A 5 ? ? -47.94 159.73 65 11 ARG A 12 ? ? 47.74 26.83 66 11 PHE A 34 ? ? -61.75 98.61 67 11 THR A 61 ? ? -38.94 -35.57 68 11 TYR A 85 ? ? -117.11 68.31 69 11 LYS A 92 ? ? -39.63 -33.43 70 12 PHE A 34 ? ? -58.72 97.99 71 12 GLU A 64 ? ? -95.35 35.52 72 12 ASP A 65 ? ? -103.93 76.82 73 12 PHE A 73 ? ? 71.55 47.88 74 12 TYR A 85 ? ? -128.41 -80.53 75 12 LYS A 92 ? ? -38.11 -31.97 76 12 PRO A 98 ? ? -69.73 8.29 77 12 SER A 100 ? ? -35.13 141.94 78 13 SER A 2 ? ? 37.69 42.76 79 13 ARG A 12 ? ? 47.83 27.03 80 13 LYS A 92 ? ? -33.89 -33.70 81 14 ASP A 52 ? ? 72.47 41.64 82 14 THR A 61 ? ? -39.62 -38.54 83 14 THR A 62 ? ? -37.35 136.44 84 14 TYR A 85 ? ? -119.76 74.16 85 14 SER A 99 ? ? -92.54 42.96 86 15 PHE A 34 ? ? -69.64 99.45 87 15 CYS A 60 ? ? -91.89 -63.63 88 15 THR A 62 ? ? -38.48 143.15 89 15 SER A 66 ? ? -171.12 133.86 90 15 PHE A 73 ? ? 72.12 50.92 91 15 LYS A 92 ? ? -34.33 -32.93 92 15 SER A 100 ? ? -130.07 -55.51 93 16 SER A 6 ? ? -105.90 79.62 94 16 LYS A 20 ? ? -59.21 105.03 95 16 THR A 61 ? ? -38.32 -27.17 96 16 GLU A 64 ? ? -49.85 158.31 97 16 ASP A 65 ? ? -86.80 41.64 98 16 TYR A 85 ? ? -114.67 -78.79 99 16 LYS A 92 ? ? -33.63 -38.00 100 16 SER A 100 ? ? -35.20 137.00 101 17 SER A 5 ? ? -83.27 45.55 102 17 SER A 6 ? ? -99.17 -63.56 103 17 ARG A 12 ? ? 46.46 25.46 104 17 PHE A 34 ? ? -59.92 109.38 105 17 LEU A 43 ? ? -98.35 32.49 106 17 ASP A 65 ? ? -60.07 76.46 107 17 TYR A 85 ? ? -114.55 -77.88 108 17 HIS A 91 ? ? -49.16 160.21 109 18 ARG A 12 ? ? 36.85 39.23 110 18 ASN A 26 ? ? 48.76 26.89 111 18 THR A 47 ? ? -46.03 156.86 112 18 ALA A 78 ? ? -52.00 -74.72 113 18 SER A 99 ? ? -37.51 135.97 114 18 SER A 100 ? ? -36.46 150.63 115 19 ARG A 12 ? ? 31.71 36.40 116 19 PHE A 34 ? ? -59.05 100.94 117 19 PHE A 73 ? ? 73.59 52.56 118 19 SER A 99 ? ? -83.04 49.12 119 20 PHE A 34 ? ? -55.89 103.24 120 20 CYS A 60 ? ? -84.43 -70.29 121 20 THR A 62 ? ? -49.34 -179.81 122 20 ARG A 63 ? ? -47.80 172.65 123 20 SER A 66 ? ? -34.81 138.77 124 20 GLN A 81 ? ? -36.28 120.78 125 20 LYS A 92 ? ? -36.03 -31.04 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #