data_2CUQ # _entry.id 2CUQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2CUQ pdb_00002cuq 10.2210/pdb2cuq/pdb RCSB RCSB024641 ? ? WWPDB D_1000024641 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002003711.2 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CUQ _pdbx_database_status.recvd_initial_deposition_date 2005-05-27 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Niraula, T.N.' 1 'Saito, K.' 2 'Koshiba, S.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution Structure of Second Lim Domain from Human Skeletal Muscle Lim-Protein 2' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Niraula, T.N.' 1 ? primary 'Saito, K.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Yokoyama, S.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Four and a half LIM domains 3' 8555.468 1 ? ? 'LIM domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFASGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFASGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002003711.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 PRO n 1 9 CYS n 1 10 TYR n 1 11 GLU n 1 12 ASN n 1 13 LYS n 1 14 PHE n 1 15 ALA n 1 16 PRO n 1 17 ARG n 1 18 CYS n 1 19 ALA n 1 20 ARG n 1 21 CYS n 1 22 SER n 1 23 LYS n 1 24 THR n 1 25 LEU n 1 26 THR n 1 27 GLN n 1 28 GLY n 1 29 GLY n 1 30 VAL n 1 31 THR n 1 32 TYR n 1 33 ARG n 1 34 ASP n 1 35 GLN n 1 36 PRO n 1 37 TRP n 1 38 HIS n 1 39 ARG n 1 40 GLU n 1 41 CYS n 1 42 LEU n 1 43 VAL n 1 44 CYS n 1 45 THR n 1 46 GLY n 1 47 CYS n 1 48 GLN n 1 49 THR n 1 50 PRO n 1 51 LEU n 1 52 ALA n 1 53 GLY n 1 54 GLN n 1 55 GLN n 1 56 PHE n 1 57 THR n 1 58 SER n 1 59 ARG n 1 60 ASP n 1 61 GLU n 1 62 ASP n 1 63 PRO n 1 64 TYR n 1 65 CYS n 1 66 VAL n 1 67 ALA n 1 68 CYS n 1 69 PHE n 1 70 GLY n 1 71 GLU n 1 72 LEU n 1 73 PHE n 1 74 ALA n 1 75 SER n 1 76 GLY n 1 77 PRO n 1 78 SER n 1 79 SER n 1 80 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene FHL3 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P040830-08 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FHL3_HUMAN _struct_ref.pdbx_db_accession Q13643 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code PCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFA _struct_ref.pdbx_align_begin 152 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CUQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 74 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q13643 _struct_ref_seq.db_align_beg 152 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 218 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 74 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2CUQ GLY A 1 ? UNP Q13643 ? ? 'cloning artifact' 1 1 1 2CUQ SER A 2 ? UNP Q13643 ? ? 'cloning artifact' 2 2 1 2CUQ SER A 3 ? UNP Q13643 ? ? 'cloning artifact' 3 3 1 2CUQ GLY A 4 ? UNP Q13643 ? ? 'cloning artifact' 4 4 1 2CUQ SER A 5 ? UNP Q13643 ? ? 'cloning artifact' 5 5 1 2CUQ SER A 6 ? UNP Q13643 ? ? 'cloning artifact' 6 6 1 2CUQ GLY A 7 ? UNP Q13643 ? ? 'cloning artifact' 7 7 1 2CUQ SER A 75 ? UNP Q13643 ? ? 'cloning artifact' 75 8 1 2CUQ GLY A 76 ? UNP Q13643 ? ? 'cloning artifact' 76 9 1 2CUQ PRO A 77 ? UNP Q13643 ? ? 'cloning artifact' 77 10 1 2CUQ SER A 78 ? UNP Q13643 ? ? 'cloning artifact' 78 11 1 2CUQ SER A 79 ? UNP Q13643 ? ? 'cloning artifact' 79 12 1 2CUQ GLY A 80 ? UNP Q13643 ? ? 'cloning artifact' 80 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120 _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.40mM LIM domain U-13C 15N; 20mM d-Tris-HCl; 100mM NaCl; 1 mM d-DTT; 0.02% NaN3; 0.01mM ZnCl2; 90% H2O; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2CUQ _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2CUQ _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2CUQ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.6 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.913 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2CUQ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2CUQ _struct.title 'Solution Structure of Second Lim Domain from Human Skeletal Muscle Lim-Protein 2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CUQ _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;Four and a half LIM domains 3, LIM domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id VAL _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 66 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id PHE _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 73 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id VAL _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 66 _struct_conf.end_auth_comp_id PHE _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 73 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 18 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 18 A ZN 201 1_555 ? ? ? ? ? ? ? 2.323 ? ? metalc2 metalc ? ? A CYS 21 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 21 A ZN 201 1_555 ? ? ? ? ? ? ? 2.307 ? ? metalc3 metalc ? ? A HIS 38 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 38 A ZN 201 1_555 ? ? ? ? ? ? ? 2.374 ? ? metalc4 metalc ? ? A CYS 41 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 41 A ZN 201 1_555 ? ? ? ? ? ? ? 2.302 ? ? metalc5 metalc ? ? A CYS 44 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 44 A ZN 401 1_555 ? ? ? ? ? ? ? 2.373 ? ? metalc6 metalc ? ? A CYS 47 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 47 A ZN 401 1_555 ? ? ? ? ? ? ? 2.326 ? ? metalc7 metalc ? ? A CYS 65 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 65 A ZN 401 1_555 ? ? ? ? ? ? ? 2.327 ? ? metalc8 metalc ? ? A CYS 68 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 68 A ZN 401 1_555 ? ? ? ? ? ? ? 2.325 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 30 ? THR A 31 ? VAL A 30 THR A 31 A 2 PRO A 36 ? TRP A 37 ? PRO A 36 TRP A 37 B 1 PHE A 56 ? SER A 58 ? PHE A 56 SER A 58 B 2 PRO A 63 ? CYS A 65 ? PRO A 63 CYS A 65 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 30 ? N VAL A 30 O TRP A 37 ? O TRP A 37 B 1 2 N THR A 57 ? N THR A 57 O TYR A 64 ? O TYR A 64 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 18 ? CYS A 18 . ? 1_555 ? 2 AC1 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 3 AC1 4 HIS A 38 ? HIS A 38 . ? 1_555 ? 4 AC1 4 CYS A 41 ? CYS A 41 . ? 1_555 ? 5 AC2 4 CYS A 44 ? CYS A 44 . ? 1_555 ? 6 AC2 4 CYS A 47 ? CYS A 47 . ? 1_555 ? 7 AC2 4 CYS A 65 ? CYS A 65 . ? 1_555 ? 8 AC2 4 CYS A 68 ? CYS A 68 . ? 1_555 ? # _database_PDB_matrix.entry_id 2CUQ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2CUQ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 HIS 38 38 38 HIS HIS A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 CYS 65 65 65 CYS CYS A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 CYS 68 68 68 CYS CYS A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 GLY 80 80 80 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 21 ? A CYS 21 ? 1_555 120.4 ? 2 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 38 ? A HIS 38 ? 1_555 86.5 ? 3 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 38 ? A HIS 38 ? 1_555 113.6 ? 4 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 41 ? A CYS 41 ? 1_555 114.9 ? 5 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 41 ? A CYS 41 ? 1_555 107.1 ? 6 ND1 ? A HIS 38 ? A HIS 38 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 41 ? A CYS 41 ? 1_555 113.5 ? 7 SG ? A CYS 44 ? A CYS 44 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 47 ? A CYS 47 ? 1_555 103.2 ? 8 SG ? A CYS 44 ? A CYS 44 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 65 ? A CYS 65 ? 1_555 116.7 ? 9 SG ? A CYS 47 ? A CYS 47 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 65 ? A CYS 65 ? 1_555 111.0 ? 10 SG ? A CYS 44 ? A CYS 44 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 68 ? A CYS 68 ? 1_555 86.0 ? 11 SG ? A CYS 47 ? A CYS 47 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 68 ? A CYS 68 ? 1_555 118.7 ? 12 SG ? A CYS 65 ? A CYS 65 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 68 ? A CYS 68 ? 1_555 117.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-27 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 17 4 'Structure model' '_struct_ref_seq_dif.details' 18 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 19 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 20 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 23 ? ? -94.67 -75.23 2 1 THR A 24 ? ? -173.53 146.40 3 1 GLN A 27 ? ? -83.03 47.75 4 1 LEU A 42 ? ? -47.75 93.58 5 1 ALA A 52 ? ? -44.74 99.65 6 1 GLU A 71 ? ? -134.97 -38.10 7 1 ALA A 74 ? ? -86.64 41.02 8 1 SER A 75 ? ? -58.80 174.82 9 2 ASN A 12 ? ? -85.16 42.80 10 2 ARG A 20 ? ? -90.90 -62.65 11 2 LYS A 23 ? ? -100.30 -71.70 12 2 THR A 26 ? ? -129.31 -61.93 13 2 ARG A 39 ? ? -38.52 -39.31 14 2 LEU A 42 ? ? -50.56 101.26 15 2 ALA A 52 ? ? -46.23 104.26 16 2 GLU A 71 ? ? -132.46 -39.66 17 2 SER A 75 ? ? -105.75 42.59 18 3 SER A 2 ? ? -81.17 42.57 19 3 TYR A 10 ? ? -48.12 109.24 20 3 LYS A 23 ? ? -91.90 -75.82 21 3 THR A 24 ? ? -171.63 145.18 22 3 LEU A 42 ? ? -49.42 89.40 23 3 ALA A 52 ? ? -45.13 98.42 24 3 GLU A 71 ? ? -135.01 -42.59 25 4 SER A 3 ? ? -160.90 110.66 26 4 SER A 6 ? ? -130.83 -52.55 27 4 LYS A 23 ? ? -95.85 -75.84 28 4 ARG A 39 ? ? -38.77 -39.86 29 4 LEU A 42 ? ? -52.41 88.70 30 4 ALA A 52 ? ? -46.57 97.34 31 4 GLU A 71 ? ? -134.90 -38.25 32 4 PRO A 77 ? ? -69.79 -174.61 33 5 ALA A 15 ? ? -172.78 148.68 34 5 LYS A 23 ? ? -102.16 -72.72 35 5 ARG A 39 ? ? -34.47 -37.57 36 5 LEU A 42 ? ? -52.47 103.63 37 5 ALA A 52 ? ? -47.78 99.14 38 5 GLU A 71 ? ? -134.30 -47.18 39 6 SER A 5 ? ? -172.87 120.32 40 6 SER A 22 ? ? 70.01 49.75 41 6 LYS A 23 ? ? -99.93 -75.86 42 6 LEU A 42 ? ? -48.88 87.58 43 6 CYS A 44 ? ? -48.76 158.75 44 6 ALA A 52 ? ? -45.85 100.98 45 6 GLU A 71 ? ? -135.02 -35.22 46 7 SER A 6 ? ? -80.71 42.95 47 7 ASN A 12 ? ? -173.08 146.72 48 7 ALA A 15 ? ? -175.00 148.40 49 7 SER A 22 ? ? 72.09 44.75 50 7 LYS A 23 ? ? -94.18 -75.22 51 7 THR A 24 ? ? -174.35 148.16 52 7 ARG A 39 ? ? -35.55 -35.44 53 7 LEU A 42 ? ? -51.14 96.85 54 7 CYS A 44 ? ? -45.07 159.36 55 7 ALA A 52 ? ? -44.01 98.12 56 7 GLU A 61 ? ? 72.01 40.42 57 7 LEU A 72 ? ? -93.79 -60.16 58 8 SER A 2 ? ? 34.61 42.15 59 8 PRO A 8 ? ? -69.83 -177.28 60 8 LYS A 23 ? ? -94.45 -74.92 61 8 ARG A 39 ? ? -39.26 -33.67 62 8 LEU A 42 ? ? -50.47 93.98 63 8 ALA A 52 ? ? -45.12 98.36 64 8 GLU A 71 ? ? -134.86 -39.17 65 8 LEU A 72 ? ? -88.63 -70.42 66 9 SER A 3 ? ? -171.42 148.06 67 9 ASN A 12 ? ? -58.40 103.81 68 9 ARG A 20 ? ? -90.77 -60.71 69 9 LYS A 23 ? ? -98.91 -73.98 70 9 GLN A 27 ? ? -34.47 110.50 71 9 LEU A 42 ? ? -51.08 86.97 72 9 CYS A 44 ? ? -46.08 159.90 73 9 ALA A 52 ? ? -44.22 99.96 74 9 GLU A 71 ? ? -134.98 -44.04 75 9 PRO A 77 ? ? -69.76 93.40 76 10 PRO A 8 ? ? -69.80 79.34 77 10 GLU A 11 ? ? -108.65 40.32 78 10 ASN A 12 ? ? -122.12 -57.08 79 10 LYS A 13 ? ? -90.82 44.55 80 10 LYS A 23 ? ? -92.36 -75.17 81 10 THR A 24 ? ? -170.21 149.36 82 10 LEU A 42 ? ? -48.64 104.59 83 10 ALA A 52 ? ? -43.59 98.44 84 10 GLU A 71 ? ? -135.00 -35.39 85 10 LEU A 72 ? ? -91.95 -65.82 86 10 PRO A 77 ? ? -69.81 9.00 87 11 SER A 5 ? ? -125.40 -56.84 88 11 CYS A 9 ? ? -174.96 108.92 89 11 SER A 22 ? ? 74.36 49.70 90 11 LYS A 23 ? ? -100.53 -75.26 91 11 THR A 24 ? ? -173.58 148.65 92 11 ARG A 39 ? ? -36.61 -34.99 93 11 LEU A 42 ? ? -49.70 100.25 94 11 ALA A 52 ? ? -37.22 100.11 95 11 GLU A 71 ? ? -134.97 -41.79 96 11 SER A 75 ? ? -66.59 82.55 97 11 PRO A 77 ? ? -69.81 88.61 98 12 PRO A 8 ? ? -69.76 88.70 99 12 LYS A 23 ? ? -96.13 -75.75 100 12 ARG A 39 ? ? -38.35 -38.07 101 12 LEU A 42 ? ? -50.66 94.49 102 12 ALA A 52 ? ? -45.97 95.04 103 12 GLU A 71 ? ? -135.00 -45.00 104 13 PRO A 8 ? ? -69.76 5.13 105 13 PHE A 14 ? ? -49.42 -18.60 106 13 SER A 22 ? ? 70.60 50.49 107 13 LYS A 23 ? ? -98.65 -73.11 108 13 THR A 26 ? ? -131.40 -62.10 109 13 GLN A 27 ? ? -62.11 99.09 110 13 LEU A 42 ? ? -46.28 103.00 111 13 ALA A 52 ? ? -48.70 98.34 112 13 GLU A 71 ? ? -134.85 -35.93 113 13 PRO A 77 ? ? -69.78 3.99 114 13 SER A 79 ? ? 37.95 43.23 115 14 ARG A 20 ? ? -92.51 -64.21 116 14 LYS A 23 ? ? -96.90 -78.29 117 14 ARG A 39 ? ? -33.81 -36.83 118 14 LEU A 42 ? ? -46.53 95.26 119 14 ALA A 52 ? ? -48.62 98.59 120 14 GLU A 71 ? ? -135.03 -45.64 121 14 SER A 78 ? ? -107.39 42.00 122 15 ASN A 12 ? ? -90.89 -61.03 123 15 SER A 22 ? ? 71.38 49.86 124 15 LYS A 23 ? ? -95.63 -75.02 125 15 THR A 26 ? ? -134.17 -38.18 126 15 ARG A 39 ? ? -39.92 -32.82 127 15 LEU A 42 ? ? -50.74 96.49 128 15 ALA A 52 ? ? -47.90 98.19 129 15 SER A 79 ? ? -100.70 42.44 130 16 PRO A 8 ? ? -69.83 89.22 131 16 CYS A 9 ? ? -171.86 115.76 132 16 GLU A 11 ? ? -99.57 42.63 133 16 LYS A 23 ? ? -100.12 -73.86 134 16 LEU A 42 ? ? -46.77 99.46 135 16 ALA A 52 ? ? -48.46 98.60 136 16 GLU A 71 ? ? -134.91 -42.68 137 16 PRO A 77 ? ? -69.80 1.45 138 17 ASN A 12 ? ? -76.42 48.19 139 17 LYS A 23 ? ? -95.48 -75.03 140 17 GLN A 27 ? ? -33.20 108.95 141 17 LEU A 42 ? ? -50.59 97.48 142 17 ALA A 52 ? ? -45.22 100.23 143 17 GLU A 71 ? ? -135.00 -36.84 144 17 LEU A 72 ? ? -90.02 -63.73 145 17 SER A 75 ? ? -174.62 140.42 146 17 PRO A 77 ? ? -69.78 16.44 147 17 SER A 78 ? ? -76.18 48.24 148 18 SER A 2 ? ? -170.93 106.00 149 18 SER A 3 ? ? -102.17 42.11 150 18 SER A 22 ? ? 71.10 50.31 151 18 LYS A 23 ? ? -104.20 -71.13 152 18 ARG A 39 ? ? -36.10 -36.06 153 18 LEU A 42 ? ? -49.26 92.17 154 18 ALA A 52 ? ? -45.98 100.47 155 18 GLU A 71 ? ? -134.77 -39.05 156 19 SER A 3 ? ? -173.15 130.55 157 19 ALA A 15 ? ? -174.63 147.80 158 19 CYS A 18 ? ? -39.83 126.84 159 19 SER A 22 ? ? 72.36 49.60 160 19 LYS A 23 ? ? -93.72 -75.47 161 19 THR A 24 ? ? -173.75 146.05 162 19 ARG A 39 ? ? -33.14 -35.07 163 19 LEU A 42 ? ? -49.85 99.52 164 19 CYS A 44 ? ? -48.71 156.16 165 19 ALA A 52 ? ? -46.28 94.76 166 19 GLU A 71 ? ? -133.68 -45.18 167 20 SER A 2 ? ? -167.78 111.50 168 20 PRO A 8 ? ? -69.76 98.23 169 20 GLU A 11 ? ? -164.01 118.86 170 20 ARG A 20 ? ? -92.46 -63.46 171 20 LYS A 23 ? ? -93.33 -75.70 172 20 THR A 24 ? ? -171.04 144.77 173 20 ARG A 39 ? ? -36.72 -39.20 174 20 LEU A 42 ? ? -49.35 89.93 175 20 ALA A 52 ? ? -48.44 101.09 176 20 GLU A 71 ? ? -134.99 -34.99 177 20 LEU A 72 ? ? -94.56 -62.99 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #