data_2CUR # _entry.id 2CUR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2CUR pdb_00002cur 10.2210/pdb2cur/pdb RCSB RCSB024642 ? ? WWPDB D_1000024642 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hss001003796.3 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CUR _pdbx_database_status.recvd_initial_deposition_date 2005-05-27 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Niraula, T.N.' 1 'Tomizawa, T.' 2 'Koshiba, S.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution structure of Skeletal muscle LIM-protein 1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Niraula, T.N.' 1 ? primary 'Tomizawa, T.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Yokoyama, S.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Skeletal muscle LIM-protein 1' 7349.195 1 ? ? 'LIM domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'SLIM 1, SLIM, Four and a half LIM domains protein 1, FHL-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGCVKCNKAITSGGITYQDQPWHADCFVCVTCSKKLAGQRFTAVEDQYYCVDCYKNFVSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGCVKCNKAITSGGITYQDQPWHADCFVCVTCSKKLAGQRFTAVEDQYYCVDCYKNFVSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hss001003796.3 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 CYS n 1 9 VAL n 1 10 LYS n 1 11 CYS n 1 12 ASN n 1 13 LYS n 1 14 ALA n 1 15 ILE n 1 16 THR n 1 17 SER n 1 18 GLY n 1 19 GLY n 1 20 ILE n 1 21 THR n 1 22 TYR n 1 23 GLN n 1 24 ASP n 1 25 GLN n 1 26 PRO n 1 27 TRP n 1 28 HIS n 1 29 ALA n 1 30 ASP n 1 31 CYS n 1 32 PHE n 1 33 VAL n 1 34 CYS n 1 35 VAL n 1 36 THR n 1 37 CYS n 1 38 SER n 1 39 LYS n 1 40 LYS n 1 41 LEU n 1 42 ALA n 1 43 GLY n 1 44 GLN n 1 45 ARG n 1 46 PHE n 1 47 THR n 1 48 ALA n 1 49 VAL n 1 50 GLU n 1 51 ASP n 1 52 GLN n 1 53 TYR n 1 54 TYR n 1 55 CYS n 1 56 VAL n 1 57 ASP n 1 58 CYS n 1 59 TYR n 1 60 LYS n 1 61 ASN n 1 62 PHE n 1 63 VAL n 1 64 SER n 1 65 GLY n 1 66 PRO n 1 67 SER n 1 68 SER n 1 69 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene FHL1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P040816-02 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FHL1_HUMAN _struct_ref.pdbx_db_accession Q13642 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code CVKCNKAITSGGITYQDQPWHADCFVCVTCSKKLAGQRFTAVEDQYYCVDCYKNFV _struct_ref.pdbx_align_begin 161 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CUR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 63 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q13642 _struct_ref_seq.db_align_beg 161 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 216 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 63 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2CUR GLY A 1 ? UNP Q13642 ? ? 'cloning artifact' 1 1 1 2CUR SER A 2 ? UNP Q13642 ? ? 'cloning artifact' 2 2 1 2CUR SER A 3 ? UNP Q13642 ? ? 'cloning artifact' 3 3 1 2CUR GLY A 4 ? UNP Q13642 ? ? 'cloning artifact' 4 4 1 2CUR SER A 5 ? UNP Q13642 ? ? 'cloning artifact' 5 5 1 2CUR SER A 6 ? UNP Q13642 ? ? 'cloning artifact' 6 6 1 2CUR GLY A 7 ? UNP Q13642 ? ? 'cloning artifact' 7 7 1 2CUR SER A 64 ? UNP Q13642 ? ? 'cloning artifact' 64 8 1 2CUR GLY A 65 ? UNP Q13642 ? ? 'cloning artifact' 65 9 1 2CUR PRO A 66 ? UNP Q13642 ? ? 'cloning artifact' 66 10 1 2CUR SER A 67 ? UNP Q13642 ? ? 'cloning artifact' 67 11 1 2CUR SER A 68 ? UNP Q13642 ? ? 'cloning artifact' 68 12 1 2CUR GLY A 69 ? UNP Q13642 ? ? 'cloning artifact' 69 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120 _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.70mM LIM domain U-13C 15N; 20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 0.01mM ZnCl2; 90% H2O; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2CUR _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2CUR _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2CUR _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.6 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.913 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P' 5 refinement CYANA 2.0.17 'Guntert, P' 6 # _exptl.entry_id 2CUR _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2CUR _struct.title 'Solution structure of Skeletal muscle LIM-protein 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CUR _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text ;LIM, Four and a half LIM domains protein 1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id VAL _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 56 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id SER _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 64 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id VAL _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 56 _struct_conf.end_auth_comp_id SER _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 64 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 8 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 8 A ZN 201 1_555 ? ? ? ? ? ? ? 2.328 ? ? metalc2 metalc ? ? A CYS 11 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 11 A ZN 201 1_555 ? ? ? ? ? ? ? 2.357 ? ? metalc3 metalc ? ? A HIS 28 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 28 A ZN 201 1_555 ? ? ? ? ? ? ? 2.360 ? ? metalc4 metalc ? ? A CYS 31 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 31 A ZN 201 1_555 ? ? ? ? ? ? ? 2.316 ? ? metalc5 metalc ? ? A CYS 34 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 34 A ZN 401 1_555 ? ? ? ? ? ? ? 2.324 ? ? metalc6 metalc ? ? A CYS 37 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 37 A ZN 401 1_555 ? ? ? ? ? ? ? 2.334 ? ? metalc7 metalc ? ? A CYS 55 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 55 A ZN 401 1_555 ? ? ? ? ? ? ? 2.320 ? ? metalc8 metalc ? ? A CYS 58 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 58 A ZN 401 1_555 ? ? ? ? ? ? ? 2.320 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 20 ? TYR A 22 ? ILE A 20 TYR A 22 A 2 GLN A 25 ? TRP A 27 ? GLN A 25 TRP A 27 B 1 PHE A 46 ? ALA A 48 ? PHE A 46 ALA A 48 B 2 TYR A 53 ? CYS A 55 ? TYR A 53 CYS A 55 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 20 ? N ILE A 20 O TRP A 27 ? O TRP A 27 B 1 2 N THR A 47 ? N THR A 47 O TYR A 54 ? O TYR A 54 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 8 ? CYS A 8 . ? 1_555 ? 2 AC1 4 CYS A 11 ? CYS A 11 . ? 1_555 ? 3 AC1 4 HIS A 28 ? HIS A 28 . ? 1_555 ? 4 AC1 4 CYS A 31 ? CYS A 31 . ? 1_555 ? 5 AC2 4 CYS A 34 ? CYS A 34 . ? 1_555 ? 6 AC2 4 CYS A 37 ? CYS A 37 . ? 1_555 ? 7 AC2 4 CYS A 55 ? CYS A 55 . ? 1_555 ? 8 AC2 4 CYS A 58 ? CYS A 58 . ? 1_555 ? # _database_PDB_matrix.entry_id 2CUR _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2CUR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 TRP 27 27 27 TRP TRP A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 CYS 55 55 55 CYS CYS A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 CYS 58 58 58 CYS CYS A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 GLY 69 69 69 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 8 ? A CYS 8 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 11 ? A CYS 11 ? 1_555 89.5 ? 2 SG ? A CYS 8 ? A CYS 8 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 28 ? A HIS 28 ? 1_555 115.0 ? 3 SG ? A CYS 11 ? A CYS 11 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 28 ? A HIS 28 ? 1_555 104.7 ? 4 SG ? A CYS 8 ? A CYS 8 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 31 ? A CYS 31 ? 1_555 119.4 ? 5 SG ? A CYS 11 ? A CYS 11 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 31 ? A CYS 31 ? 1_555 104.5 ? 6 ND1 ? A HIS 28 ? A HIS 28 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 31 ? A CYS 31 ? 1_555 117.3 ? 7 SG ? A CYS 34 ? A CYS 34 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 37 ? A CYS 37 ? 1_555 89.3 ? 8 SG ? A CYS 34 ? A CYS 34 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 55 ? A CYS 55 ? 1_555 119.3 ? 9 SG ? A CYS 37 ? A CYS 37 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 55 ? A CYS 55 ? 1_555 107.2 ? 10 SG ? A CYS 34 ? A CYS 34 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 58 ? A CYS 58 ? 1_555 119.0 ? 11 SG ? A CYS 37 ? A CYS 37 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 58 ? A CYS 58 ? 1_555 109.2 ? 12 SG ? A CYS 55 ? A CYS 55 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 58 ? A CYS 58 ? 1_555 109.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-27 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 17 4 'Structure model' '_struct_ref_seq_dif.details' 18 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 19 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 20 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 8 ? ? -58.21 -178.94 2 1 LYS A 10 ? ? -78.72 -75.88 3 1 THR A 16 ? ? -64.53 -179.67 4 1 SER A 17 ? ? -83.28 37.09 5 1 PHE A 32 ? ? -85.40 30.11 6 1 VAL A 35 ? ? -84.17 35.53 7 1 THR A 36 ? ? -132.30 -76.04 8 1 LYS A 40 ? ? -66.87 99.99 9 1 ASP A 51 ? ? -70.77 -72.23 10 2 SER A 2 ? ? -48.78 168.09 11 2 CYS A 8 ? ? -55.34 -178.98 12 2 LYS A 10 ? ? -81.51 -76.69 13 2 SER A 17 ? ? -82.41 39.10 14 2 PHE A 32 ? ? -83.04 39.40 15 2 VAL A 35 ? ? -93.09 34.10 16 2 THR A 36 ? ? -129.31 -75.03 17 2 ASP A 51 ? ? -71.06 -73.94 18 2 SER A 67 ? ? -37.90 106.05 19 3 CYS A 8 ? ? -51.73 -178.16 20 3 LYS A 10 ? ? -70.06 -75.07 21 3 SER A 17 ? ? -82.03 39.17 22 3 CYS A 34 ? ? -44.71 164.24 23 3 VAL A 35 ? ? -99.10 35.61 24 3 THR A 36 ? ? -131.43 -73.61 25 3 LYS A 40 ? ? -68.20 81.08 26 3 GLU A 50 ? ? -34.67 -32.76 27 4 CYS A 8 ? ? -54.35 -178.18 28 4 LYS A 10 ? ? -78.06 -75.98 29 4 THR A 16 ? ? -57.44 177.23 30 4 SER A 17 ? ? -82.08 39.15 31 4 VAL A 35 ? ? -95.86 37.04 32 4 THR A 36 ? ? -132.81 -72.98 33 4 LYS A 40 ? ? -55.05 97.73 34 4 PRO A 66 ? ? -69.76 -174.59 35 4 SER A 67 ? ? -48.08 101.00 36 5 SER A 5 ? ? -54.65 173.77 37 5 CYS A 8 ? ? -56.24 -178.84 38 5 LYS A 10 ? ? -83.23 -75.35 39 5 ALA A 14 ? ? -48.69 153.70 40 5 THR A 16 ? ? -55.51 177.62 41 5 SER A 17 ? ? -81.59 39.15 42 5 THR A 36 ? ? -133.00 -74.99 43 5 SER A 38 ? ? 71.72 52.86 44 5 GLU A 50 ? ? -36.41 -33.64 45 5 ASP A 51 ? ? -77.88 -74.68 46 6 CYS A 8 ? ? -55.22 -178.52 47 6 LYS A 10 ? ? -75.83 -75.76 48 6 SER A 17 ? ? -78.48 39.96 49 6 VAL A 35 ? ? -88.81 35.37 50 6 THR A 36 ? ? -129.78 -75.93 51 6 ALA A 42 ? ? -47.26 109.47 52 6 GLU A 50 ? ? -35.16 -37.28 53 6 ASP A 51 ? ? -86.05 -76.40 54 6 PRO A 66 ? ? -69.72 3.81 55 7 CYS A 8 ? ? -54.58 -179.00 56 7 LYS A 10 ? ? -71.54 -75.28 57 7 ASN A 12 ? ? 73.39 53.57 58 7 SER A 17 ? ? -79.98 39.60 59 7 PHE A 32 ? ? -83.14 35.78 60 7 VAL A 35 ? ? -97.53 36.57 61 7 THR A 36 ? ? -133.59 -73.51 62 7 GLU A 50 ? ? -36.90 -30.30 63 7 ASP A 51 ? ? -79.80 -71.61 64 7 ASP A 57 ? ? -49.79 -70.75 65 7 PRO A 66 ? ? -69.83 3.35 66 7 SER A 67 ? ? -105.65 40.72 67 8 SER A 6 ? ? 34.36 40.03 68 8 CYS A 8 ? ? -52.01 -179.36 69 8 LYS A 10 ? ? -72.73 -74.28 70 8 SER A 17 ? ? -81.64 39.04 71 8 PHE A 32 ? ? -84.75 30.34 72 8 VAL A 35 ? ? -94.83 36.40 73 8 THR A 36 ? ? -133.87 -75.19 74 8 GLU A 50 ? ? -32.75 -38.80 75 8 SER A 68 ? ? -52.22 106.73 76 9 CYS A 8 ? ? -68.47 -178.18 77 9 LYS A 10 ? ? -74.06 -75.51 78 9 SER A 17 ? ? -81.28 39.32 79 9 VAL A 35 ? ? -92.90 37.09 80 9 THR A 36 ? ? -132.76 -70.44 81 9 SER A 64 ? ? -54.56 173.83 82 9 SER A 67 ? ? -172.51 121.16 83 10 SER A 2 ? ? -81.93 41.37 84 10 SER A 3 ? ? -81.31 42.67 85 10 CYS A 8 ? ? -53.55 -178.15 86 10 LYS A 10 ? ? -72.71 -75.87 87 10 SER A 17 ? ? -81.82 39.20 88 10 PHE A 32 ? ? -83.94 34.36 89 10 THR A 36 ? ? -128.18 -74.76 90 10 GLU A 50 ? ? -29.58 -43.44 91 10 ASP A 51 ? ? -69.03 -72.57 92 11 CYS A 8 ? ? -53.40 -178.78 93 11 LYS A 10 ? ? -76.27 -75.80 94 11 SER A 17 ? ? -81.90 39.12 95 11 VAL A 35 ? ? -95.84 36.38 96 11 THR A 36 ? ? -130.10 -72.25 97 11 ALA A 42 ? ? -39.55 111.63 98 11 GLU A 50 ? ? -36.06 -31.12 99 11 PRO A 66 ? ? -69.75 85.25 100 12 SER A 6 ? ? -52.01 176.55 101 12 CYS A 8 ? ? -62.26 -178.74 102 12 LYS A 10 ? ? -70.98 -75.03 103 12 ASN A 12 ? ? 74.37 50.17 104 12 THR A 16 ? ? -46.98 175.42 105 12 SER A 17 ? ? -79.48 39.64 106 12 PHE A 32 ? ? -84.16 31.26 107 12 VAL A 35 ? ? -89.40 36.36 108 12 THR A 36 ? ? -133.42 -76.29 109 12 LYS A 40 ? ? -51.81 96.80 110 12 ALA A 42 ? ? -39.45 118.47 111 12 ASP A 51 ? ? -63.74 -72.02 112 12 ASP A 57 ? ? -51.25 -71.99 113 12 SER A 67 ? ? -64.99 85.34 114 13 SER A 6 ? ? -78.50 45.67 115 13 CYS A 8 ? ? -60.80 -177.49 116 13 LYS A 10 ? ? -76.17 -76.63 117 13 THR A 16 ? ? -58.10 -179.73 118 13 SER A 17 ? ? -82.00 39.06 119 13 PHE A 32 ? ? -85.07 32.56 120 13 VAL A 35 ? ? -94.67 36.32 121 13 THR A 36 ? ? -132.25 -74.87 122 13 LYS A 40 ? ? -55.79 93.60 123 13 GLU A 50 ? ? -34.48 -34.06 124 13 ASP A 51 ? ? -79.33 -73.62 125 13 PRO A 66 ? ? -69.72 -179.16 126 13 SER A 68 ? ? -105.23 -61.84 127 14 SER A 6 ? ? -108.03 -62.28 128 14 CYS A 8 ? ? -52.27 -178.81 129 14 LYS A 10 ? ? -78.74 -76.18 130 14 SER A 17 ? ? -81.15 39.88 131 14 PHE A 32 ? ? -84.06 32.98 132 14 VAL A 35 ? ? -97.89 34.60 133 14 THR A 36 ? ? -131.29 -74.61 134 14 GLU A 50 ? ? -32.56 -39.94 135 14 ASP A 51 ? ? -73.40 -73.12 136 14 PRO A 66 ? ? -69.81 96.53 137 15 SER A 6 ? ? -92.47 42.09 138 15 CYS A 8 ? ? -53.45 -178.19 139 15 LYS A 10 ? ? -69.76 -76.02 140 15 THR A 16 ? ? -51.26 -178.40 141 15 SER A 17 ? ? -76.65 39.54 142 15 VAL A 35 ? ? -99.76 36.69 143 15 THR A 36 ? ? -132.79 -67.78 144 15 GLU A 50 ? ? -34.90 -31.95 145 15 ASP A 51 ? ? -79.57 -73.59 146 15 SER A 64 ? ? -57.63 109.54 147 16 CYS A 8 ? ? -53.29 -178.59 148 16 LYS A 10 ? ? -87.38 -78.26 149 16 SER A 17 ? ? -80.37 39.42 150 16 VAL A 35 ? ? -93.04 30.61 151 16 THR A 36 ? ? -128.77 -76.89 152 17 CYS A 8 ? ? -66.70 -178.43 153 17 LYS A 10 ? ? -72.93 -75.87 154 17 THR A 16 ? ? -56.99 178.55 155 17 SER A 17 ? ? -81.18 39.13 156 17 PHE A 32 ? ? -83.63 33.52 157 17 VAL A 35 ? ? -94.18 32.02 158 17 THR A 36 ? ? -129.53 -74.78 159 17 PRO A 66 ? ? -69.78 3.75 160 18 SER A 6 ? ? -61.82 98.48 161 18 CYS A 8 ? ? -52.27 -177.29 162 18 LYS A 10 ? ? -74.05 -76.47 163 18 SER A 17 ? ? -81.32 39.44 164 18 PHE A 32 ? ? -83.25 36.25 165 18 VAL A 35 ? ? -93.98 36.23 166 18 THR A 36 ? ? -131.92 -74.97 167 18 ALA A 42 ? ? -48.12 109.53 168 18 GLU A 50 ? ? -29.32 -43.14 169 18 ASP A 51 ? ? -65.61 -70.49 170 18 PRO A 66 ? ? -69.75 94.36 171 19 SER A 2 ? ? -47.38 166.43 172 19 SER A 5 ? ? -171.47 120.17 173 19 CYS A 8 ? ? -58.80 -179.41 174 19 LYS A 10 ? ? -73.09 -74.56 175 19 THR A 16 ? ? -48.66 172.21 176 19 SER A 17 ? ? -78.26 40.20 177 19 PHE A 32 ? ? -84.81 30.45 178 19 THR A 36 ? ? -123.39 -77.30 179 19 LYS A 40 ? ? -48.74 109.74 180 19 VAL A 56 ? ? -35.39 -37.32 181 20 SER A 6 ? ? -37.75 116.91 182 20 CYS A 8 ? ? -52.62 -178.60 183 20 LYS A 10 ? ? -74.32 -75.61 184 20 THR A 16 ? ? -51.72 -178.33 185 20 SER A 17 ? ? -77.71 37.73 186 20 PHE A 32 ? ? -83.38 33.34 187 20 CYS A 34 ? ? -58.94 171.36 188 20 THR A 36 ? ? -132.63 -74.88 189 20 LYS A 40 ? ? -65.84 84.58 190 20 ALA A 42 ? ? -46.62 109.00 191 20 GLU A 50 ? ? -36.13 -39.21 192 20 TYR A 59 ? ? -38.72 -39.11 193 20 PRO A 66 ? ? -69.73 88.25 194 20 SER A 67 ? ? -164.55 112.18 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #