data_2CW1 # _entry.id 2CW1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2CW1 pdb_00002cw1 10.2210/pdb2cw1/pdb RCSB RCSB024687 ? ? WWPDB D_1000024687 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CW1 _pdbx_database_status.recvd_initial_deposition_date 2005-06-15 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Isogai, Y.' 1 'Ito, Y.' 2 'Ikeya, T.' 3 'Shiro, Y.' 4 'Ota, M.' 5 # _citation.id primary _citation.title 'Design of lambda Cro fold: solution structure of a monomeric variant of the de novo protein.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 354 _citation.page_first 801 _citation.page_last 814 _citation.year 2005 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16289118 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2005.10.005 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Isogai, Y.' 1 ? primary 'Ito, Y.' 2 ? primary 'Ikeya, T.' 3 ? primary 'Shiro, Y.' 4 ? primary 'Ota, M.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description SN4m _entity.formula_weight 7488.702 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MRKKLDLKKFVEDKNQEYAARALGLSQKLIEEVLKRGLPVYVETNKDGNIKVYITQDGITQPFPP _entity_poly.pdbx_seq_one_letter_code_can MRKKLDLKKFVEDKNQEYAARALGLSQKLIEEVLKRGLPVYVETNKDGNIKVYITQDGITQPFPP _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 LYS n 1 4 LYS n 1 5 LEU n 1 6 ASP n 1 7 LEU n 1 8 LYS n 1 9 LYS n 1 10 PHE n 1 11 VAL n 1 12 GLU n 1 13 ASP n 1 14 LYS n 1 15 ASN n 1 16 GLN n 1 17 GLU n 1 18 TYR n 1 19 ALA n 1 20 ALA n 1 21 ARG n 1 22 ALA n 1 23 LEU n 1 24 GLY n 1 25 LEU n 1 26 SER n 1 27 GLN n 1 28 LYS n 1 29 LEU n 1 30 ILE n 1 31 GLU n 1 32 GLU n 1 33 VAL n 1 34 LEU n 1 35 LYS n 1 36 ARG n 1 37 GLY n 1 38 LEU n 1 39 PRO n 1 40 VAL n 1 41 TYR n 1 42 VAL n 1 43 GLU n 1 44 THR n 1 45 ASN n 1 46 LYS n 1 47 ASP n 1 48 GLY n 1 49 ASN n 1 50 ILE n 1 51 LYS n 1 52 VAL n 1 53 TYR n 1 54 ILE n 1 55 THR n 1 56 GLN n 1 57 ASP n 1 58 GLY n 1 59 ILE n 1 60 THR n 1 61 GLN n 1 62 PRO n 1 63 PHE n 1 64 PRO n 1 65 PRO n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'Chemically synthesized' # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name PDB _struct_ref.db_code 2CW1 _struct_ref.pdbx_db_accession 2CW1 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CW1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 65 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 2CW1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 65 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 65 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '200mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.8mM SN4m U-15N,13C; 10mM sodium phosphate buffer (pH 7.0) containing 200mM NaCl; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2CW1 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2CW1 _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_ensemble.entry_id 2CW1 _pdbx_nmr_ensemble.conformers_calculated_total_number 80 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2CW1 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.6 Bruker 1 processing Azara 2.7 Boucher 2 'data analysis' ANSIG 3.3 Kraulis 3 'structure solution' CNS 1.1 Brunger 4 refinement CNS 1.1 ? 5 # _exptl.entry_id 2CW1 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2CW1 _struct.title 'Solution structure of the de novo-designed lambda Cro fold protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CW1 _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' _struct_keywords.text 'LAMBDA CRO FOLD, DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 6 ? GLU A 12 ? ASP A 6 GLU A 12 1 ? 7 HELX_P HELX_P2 2 ASN A 15 ? LEU A 23 ? ASN A 15 LEU A 23 1 ? 9 HELX_P HELX_P3 3 SER A 26 ? ARG A 36 ? SER A 26 ARG A 36 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 43 ? THR A 44 ? GLU A 43 THR A 44 A 2 ILE A 50 ? LYS A 51 ? ILE A 50 LYS A 51 B 1 TYR A 53 ? GLN A 56 ? TYR A 53 GLN A 56 B 2 ILE A 59 ? PRO A 62 ? ILE A 59 PRO A 62 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLU A 43 ? N GLU A 43 O LYS A 51 ? O LYS A 51 B 1 2 N ILE A 54 ? N ILE A 54 O GLN A 61 ? O GLN A 61 # _database_PDB_matrix.entry_id 2CW1 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2CW1 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 PRO 65 65 65 PRO PRO A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-12-13 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 3 _pdbx_validate_close_contact.auth_atom_id_1 HD21 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASN _pdbx_validate_close_contact.auth_seq_id_1 49 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ILE _pdbx_validate_close_contact.auth_seq_id_2 50 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.34 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 6 ? ? -63.52 90.02 2 1 LYS A 14 ? ? -146.17 -56.16 3 1 ASN A 15 ? ? 168.86 -153.04 4 1 PRO A 39 ? ? -65.98 97.22 5 1 ASN A 45 ? ? -96.84 -71.85 6 1 LYS A 46 ? ? -168.85 -71.16 7 1 TYR A 53 ? ? -65.30 84.74 8 1 PHE A 63 ? ? -17.47 89.88 9 1 PRO A 64 ? ? -104.82 41.31 10 2 LYS A 3 ? ? -102.02 68.75 11 2 ASP A 6 ? ? -55.28 107.35 12 2 LYS A 14 ? ? -144.19 -55.41 13 2 ASN A 15 ? ? 168.43 176.23 14 2 GLN A 16 ? ? -59.72 -6.36 15 2 ASN A 45 ? ? -96.84 -85.89 16 2 LYS A 46 ? ? -159.45 -65.88 17 2 GLN A 61 ? ? -178.62 133.41 18 2 PHE A 63 ? ? -28.33 96.91 19 2 PRO A 64 ? ? -105.56 42.50 20 3 ARG A 2 ? ? -94.28 56.05 21 3 LYS A 3 ? ? -98.53 43.98 22 3 LYS A 4 ? ? -59.73 81.01 23 3 LYS A 14 ? ? -141.68 -49.16 24 3 ASN A 15 ? ? 173.45 170.97 25 3 LEU A 23 ? ? -68.51 -175.31 26 3 GLU A 32 ? ? -61.81 -70.08 27 3 ASN A 45 ? ? -97.77 -89.60 28 3 LYS A 46 ? ? -148.35 -68.86 29 3 TYR A 53 ? ? -62.88 80.65 30 4 ARG A 2 ? ? -96.21 43.93 31 4 LYS A 3 ? ? -100.30 70.45 32 4 LYS A 14 ? ? -141.61 -56.36 33 4 ASN A 15 ? ? 172.20 176.91 34 4 LYS A 46 ? ? 73.06 -67.65 35 4 TYR A 53 ? ? -65.66 81.92 36 4 ASP A 57 ? ? 61.91 -1.86 37 5 ASP A 13 ? ? -57.84 -71.44 38 5 ASN A 15 ? ? 172.79 -165.76 39 5 LEU A 23 ? ? -66.00 -91.08 40 5 LEU A 25 ? ? -48.92 160.78 41 5 LEU A 34 ? ? -64.28 -83.24 42 5 ASN A 45 ? ? -115.68 -89.32 43 5 ASP A 47 ? ? 64.70 -4.50 44 5 ASP A 57 ? ? 64.38 -4.28 45 5 PHE A 63 ? ? -44.98 106.33 46 6 ARG A 2 ? ? -86.77 47.23 47 6 LYS A 14 ? ? -167.84 57.89 48 6 ASN A 15 ? ? 74.68 159.15 49 6 ASN A 45 ? ? -113.21 -82.92 50 6 ASP A 47 ? ? 75.10 -34.01 51 6 TYR A 53 ? ? -56.76 82.45 52 6 ASP A 57 ? ? 70.64 -7.21 53 6 PHE A 63 ? ? 2.61 83.88 54 6 PRO A 64 ? ? -103.05 45.14 55 7 LYS A 14 ? ? -151.90 -53.74 56 7 ASN A 15 ? ? 165.91 -175.17 57 7 LEU A 23 ? ? -50.75 -87.51 58 7 ASN A 45 ? ? -97.44 -93.34 59 7 LYS A 46 ? ? -145.77 -69.36 60 7 TYR A 53 ? ? -69.65 76.56 61 7 ASP A 57 ? ? 62.07 -0.46 62 8 ASP A 6 ? ? -53.95 99.90 63 8 LEU A 7 ? ? -35.54 -37.90 64 8 LYS A 14 ? ? -163.77 -51.39 65 8 ASN A 15 ? ? 162.97 166.76 66 8 GLN A 16 ? ? -47.79 -17.62 67 8 LEU A 23 ? ? -54.27 -86.82 68 8 ASN A 45 ? ? -94.59 -74.87 69 8 LYS A 46 ? ? -168.62 -64.70 70 8 TYR A 53 ? ? -55.17 87.62 71 8 ASP A 57 ? ? 72.04 -13.88 72 8 PHE A 63 ? ? -5.32 83.20 73 8 PRO A 64 ? ? -105.74 45.49 74 9 ARG A 2 ? ? -164.79 47.87 75 9 LYS A 14 ? ? -146.82 -49.18 76 9 ASN A 15 ? ? 173.84 166.21 77 9 ASN A 45 ? ? -85.93 -80.80 78 9 LYS A 46 ? ? -173.22 -38.51 79 9 ASP A 57 ? ? 52.27 12.80 80 9 PHE A 63 ? ? -41.88 107.75 81 10 ASP A 6 ? ? -67.15 95.55 82 10 LYS A 14 ? ? -144.29 -55.12 83 10 ASN A 15 ? ? 170.06 -167.08 84 10 LEU A 23 ? ? -72.46 -92.68 85 10 LEU A 25 ? ? -47.86 160.32 86 10 SER A 26 ? ? -66.38 -176.95 87 10 ASN A 45 ? ? -91.19 -87.37 88 10 LYS A 46 ? ? -142.85 -72.56 #