data_2CXL # _entry.id 2CXL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2CXL pdb_00002cxl 10.2210/pdb2cxl/pdb RCSB RCSB024739 ? ? WWPDB D_1000024739 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-12-30 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2023-10-25 5 'Structure model' 1 4 2023-11-15 6 'Structure model' 1 5 2024-10-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Refinement description' 7 5 'Structure model' 'Data collection' 8 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_initial_refinement_model 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond 9 6 'Structure model' pdbx_entry_details 10 6 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 4 'Structure model' '_struct_ref_seq_dif.details' 5 5 'Structure model' '_chem_comp_atom.atom_id' 6 5 'Structure model' '_chem_comp_bond.atom_id_2' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CXL _pdbx_database_status.recvd_initial_deposition_date 2005-06-30 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2CXF 'the same protein in C2 space group' unspecified PDB 2DWG 'the same protein in P2(1)P2(1)P2(1) space group' unspecified PDB 2DWK 'the same protein in P6(4)22 space group' unspecified TargetDB mmk001003772.3 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kukimoto-Niino, M.' 1 'Umehara, T.' 2 'Murayama, K.' 3 'Shirouzu, M.' 4 'Yokoyama, S.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title 'Crystal Structure of the RUN Domain of the RAP2-interacting Protein x' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 281 _citation.page_first 31843 _citation.page_last 31853 _citation.year 2006 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16928684 _citation.pdbx_database_id_DOI 10.1074/jbc.M604960200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kukimoto-Niino, M.' 1 ? primary 'Takagi, T.' 2 ? primary 'Akasaka, R.' 3 ? primary 'Murayama, K.' 4 ? primary 'Uchikubo-Kamo, T.' 5 ? primary 'Terada, T.' 6 ? primary 'Inoue, M.' 7 ? primary 'Watanabe, S.' 8 ? primary 'Tanaka, A.' 9 ? primary 'Hayashizaki, Y.' 10 ? primary 'Kigawa, T.' 11 ? primary 'Shirouzu, M.' 12 ? primary 'Yokoyama, S.' 13 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'rap2 interacting protein x' _entity.formula_weight 21445.293 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'RUN domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GSSGSSG(MSE)ANER(MSE)NL(MSE)N(MSE)AKLSIKGLIESALNLGRTLDSDYAPLQQFFVV(MSE)EHCLKHGLK AKKTFLGQNKSFWGPLELVEKLVPEAAEITASVKDLPGLKTPVGRGRAWLRLAL(MSE)QKKLSEY(MSE)KALINKKEL LSEFYEVNAL(MSE)(MSE)EEEGAIIAGLLVGLNVIDANFC(MSE)KGEDLDSQVGVIDFS(MSE)YLKDGNS ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGMANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKAKKTFLGQNKSFWGPLELVE KLVPEAAEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYMKALINKKELLSEFYEVNALMMEEEGAIIAGLLVGLNV IDANFCMKGEDLDSQVGVIDFSMYLKDGNS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier mmk001003772.3 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 MSE n 1 9 ALA n 1 10 ASN n 1 11 GLU n 1 12 ARG n 1 13 MSE n 1 14 ASN n 1 15 LEU n 1 16 MSE n 1 17 ASN n 1 18 MSE n 1 19 ALA n 1 20 LYS n 1 21 LEU n 1 22 SER n 1 23 ILE n 1 24 LYS n 1 25 GLY n 1 26 LEU n 1 27 ILE n 1 28 GLU n 1 29 SER n 1 30 ALA n 1 31 LEU n 1 32 ASN n 1 33 LEU n 1 34 GLY n 1 35 ARG n 1 36 THR n 1 37 LEU n 1 38 ASP n 1 39 SER n 1 40 ASP n 1 41 TYR n 1 42 ALA n 1 43 PRO n 1 44 LEU n 1 45 GLN n 1 46 GLN n 1 47 PHE n 1 48 PHE n 1 49 VAL n 1 50 VAL n 1 51 MSE n 1 52 GLU n 1 53 HIS n 1 54 CYS n 1 55 LEU n 1 56 LYS n 1 57 HIS n 1 58 GLY n 1 59 LEU n 1 60 LYS n 1 61 ALA n 1 62 LYS n 1 63 LYS n 1 64 THR n 1 65 PHE n 1 66 LEU n 1 67 GLY n 1 68 GLN n 1 69 ASN n 1 70 LYS n 1 71 SER n 1 72 PHE n 1 73 TRP n 1 74 GLY n 1 75 PRO n 1 76 LEU n 1 77 GLU n 1 78 LEU n 1 79 VAL n 1 80 GLU n 1 81 LYS n 1 82 LEU n 1 83 VAL n 1 84 PRO n 1 85 GLU n 1 86 ALA n 1 87 ALA n 1 88 GLU n 1 89 ILE n 1 90 THR n 1 91 ALA n 1 92 SER n 1 93 VAL n 1 94 LYS n 1 95 ASP n 1 96 LEU n 1 97 PRO n 1 98 GLY n 1 99 LEU n 1 100 LYS n 1 101 THR n 1 102 PRO n 1 103 VAL n 1 104 GLY n 1 105 ARG n 1 106 GLY n 1 107 ARG n 1 108 ALA n 1 109 TRP n 1 110 LEU n 1 111 ARG n 1 112 LEU n 1 113 ALA n 1 114 LEU n 1 115 MSE n 1 116 GLN n 1 117 LYS n 1 118 LYS n 1 119 LEU n 1 120 SER n 1 121 GLU n 1 122 TYR n 1 123 MSE n 1 124 LYS n 1 125 ALA n 1 126 LEU n 1 127 ILE n 1 128 ASN n 1 129 LYS n 1 130 LYS n 1 131 GLU n 1 132 LEU n 1 133 LEU n 1 134 SER n 1 135 GLU n 1 136 PHE n 1 137 TYR n 1 138 GLU n 1 139 VAL n 1 140 ASN n 1 141 ALA n 1 142 LEU n 1 143 MSE n 1 144 MSE n 1 145 GLU n 1 146 GLU n 1 147 GLU n 1 148 GLY n 1 149 ALA n 1 150 ILE n 1 151 ILE n 1 152 ALA n 1 153 GLY n 1 154 LEU n 1 155 LEU n 1 156 VAL n 1 157 GLY n 1 158 LEU n 1 159 ASN n 1 160 VAL n 1 161 ILE n 1 162 ASP n 1 163 ALA n 1 164 ASN n 1 165 PHE n 1 166 CYS n 1 167 MSE n 1 168 LYS n 1 169 GLY n 1 170 GLU n 1 171 ASP n 1 172 LEU n 1 173 ASP n 1 174 SER n 1 175 GLN n 1 176 VAL n 1 177 GLY n 1 178 VAL n 1 179 ILE n 1 180 ASP n 1 181 PHE n 1 182 SER n 1 183 MSE n 1 184 TYR n 1 185 LEU n 1 186 LYS n 1 187 ASP n 1 188 GLY n 1 189 ASN n 1 190 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PX040220-04-MD01 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 76 ? ? ? A . n A 1 2 SER 2 77 ? ? ? A . n A 1 3 SER 3 78 ? ? ? A . n A 1 4 GLY 4 79 ? ? ? A . n A 1 5 SER 5 80 ? ? ? A . n A 1 6 SER 6 81 ? ? ? A . n A 1 7 GLY 7 82 ? ? ? A . n A 1 8 MSE 8 83 83 MSE MSE A . n A 1 9 ALA 9 84 84 ALA ALA A . n A 1 10 ASN 10 85 85 ASN ASN A . n A 1 11 GLU 11 86 86 GLU GLU A . n A 1 12 ARG 12 87 87 ARG ARG A . n A 1 13 MSE 13 88 88 MSE MSE A . n A 1 14 ASN 14 89 89 ASN ASN A . n A 1 15 LEU 15 90 90 LEU LEU A . n A 1 16 MSE 16 91 91 MSE MSE A . n A 1 17 ASN 17 92 92 ASN ASN A . n A 1 18 MSE 18 93 93 MSE MSE A . n A 1 19 ALA 19 94 94 ALA ALA A . n A 1 20 LYS 20 95 95 LYS LYS A . n A 1 21 LEU 21 96 96 LEU LEU A . n A 1 22 SER 22 97 97 SER SER A . n A 1 23 ILE 23 98 98 ILE ILE A . n A 1 24 LYS 24 99 99 LYS LYS A . n A 1 25 GLY 25 100 100 GLY GLY A . n A 1 26 LEU 26 101 101 LEU LEU A . n A 1 27 ILE 27 102 102 ILE ILE A . n A 1 28 GLU 28 103 103 GLU GLU A . n A 1 29 SER 29 104 104 SER SER A . n A 1 30 ALA 30 105 105 ALA ALA A . n A 1 31 LEU 31 106 106 LEU LEU A . n A 1 32 ASN 32 107 107 ASN ASN A . n A 1 33 LEU 33 108 108 LEU LEU A . n A 1 34 GLY 34 109 109 GLY GLY A . n A 1 35 ARG 35 110 110 ARG ARG A . n A 1 36 THR 36 111 111 THR THR A . n A 1 37 LEU 37 112 112 LEU LEU A . n A 1 38 ASP 38 113 113 ASP ASP A . n A 1 39 SER 39 114 114 SER SER A . n A 1 40 ASP 40 115 115 ASP ASP A . n A 1 41 TYR 41 116 116 TYR TYR A . n A 1 42 ALA 42 117 117 ALA ALA A . n A 1 43 PRO 43 118 118 PRO PRO A . n A 1 44 LEU 44 119 119 LEU LEU A . n A 1 45 GLN 45 120 120 GLN GLN A . n A 1 46 GLN 46 121 121 GLN GLN A . n A 1 47 PHE 47 122 122 PHE PHE A . n A 1 48 PHE 48 123 123 PHE PHE A . n A 1 49 VAL 49 124 124 VAL VAL A . n A 1 50 VAL 50 125 125 VAL VAL A . n A 1 51 MSE 51 126 126 MSE MSE A . n A 1 52 GLU 52 127 127 GLU GLU A . n A 1 53 HIS 53 128 128 HIS HIS A . n A 1 54 CYS 54 129 129 CYS CYS A . n A 1 55 LEU 55 130 130 LEU LEU A . n A 1 56 LYS 56 131 131 LYS LYS A . n A 1 57 HIS 57 132 132 HIS HIS A . n A 1 58 GLY 58 133 133 GLY GLY A . n A 1 59 LEU 59 134 134 LEU LEU A . n A 1 60 LYS 60 135 135 LYS LYS A . n A 1 61 ALA 61 136 136 ALA ALA A . n A 1 62 LYS 62 137 ? ? ? A . n A 1 63 LYS 63 138 ? ? ? A . n A 1 64 THR 64 139 ? ? ? A . n A 1 65 PHE 65 140 ? ? ? A . n A 1 66 LEU 66 141 ? ? ? A . n A 1 67 GLY 67 142 ? ? ? A . n A 1 68 GLN 68 143 ? ? ? A . n A 1 69 ASN 69 144 144 ASN ASN A . n A 1 70 LYS 70 145 145 LYS LYS A . n A 1 71 SER 71 146 146 SER SER A . n A 1 72 PHE 72 147 147 PHE PHE A . n A 1 73 TRP 73 148 148 TRP TRP A . n A 1 74 GLY 74 149 149 GLY GLY A . n A 1 75 PRO 75 150 150 PRO PRO A . n A 1 76 LEU 76 151 151 LEU LEU A . n A 1 77 GLU 77 152 152 GLU GLU A . n A 1 78 LEU 78 153 153 LEU LEU A . n A 1 79 VAL 79 154 154 VAL VAL A . n A 1 80 GLU 80 155 155 GLU GLU A . n A 1 81 LYS 81 156 156 LYS LYS A . n A 1 82 LEU 82 157 157 LEU LEU A . n A 1 83 VAL 83 158 158 VAL VAL A . n A 1 84 PRO 84 159 159 PRO PRO A . n A 1 85 GLU 85 160 160 GLU GLU A . n A 1 86 ALA 86 161 161 ALA ALA A . n A 1 87 ALA 87 162 162 ALA ALA A . n A 1 88 GLU 88 163 163 GLU GLU A . n A 1 89 ILE 89 164 164 ILE ILE A . n A 1 90 THR 90 165 165 THR THR A . n A 1 91 ALA 91 166 166 ALA ALA A . n A 1 92 SER 92 167 167 SER SER A . n A 1 93 VAL 93 168 168 VAL VAL A . n A 1 94 LYS 94 169 169 LYS LYS A . n A 1 95 ASP 95 170 170 ASP ASP A . n A 1 96 LEU 96 171 171 LEU LEU A . n A 1 97 PRO 97 172 172 PRO PRO A . n A 1 98 GLY 98 173 173 GLY GLY A . n A 1 99 LEU 99 174 174 LEU LEU A . n A 1 100 LYS 100 175 175 LYS LYS A . n A 1 101 THR 101 176 176 THR THR A . n A 1 102 PRO 102 177 177 PRO PRO A . n A 1 103 VAL 103 178 178 VAL VAL A . n A 1 104 GLY 104 179 179 GLY GLY A . n A 1 105 ARG 105 180 180 ARG ARG A . n A 1 106 GLY 106 181 181 GLY GLY A . n A 1 107 ARG 107 182 182 ARG ARG A . n A 1 108 ALA 108 183 183 ALA ALA A . n A 1 109 TRP 109 184 184 TRP TRP A . n A 1 110 LEU 110 185 185 LEU LEU A . n A 1 111 ARG 111 186 186 ARG ARG A . n A 1 112 LEU 112 187 187 LEU LEU A . n A 1 113 ALA 113 188 188 ALA ALA A . n A 1 114 LEU 114 189 189 LEU LEU A . n A 1 115 MSE 115 190 190 MSE MSE A . n A 1 116 GLN 116 191 191 GLN GLN A . n A 1 117 LYS 117 192 192 LYS LYS A . n A 1 118 LYS 118 193 193 LYS LYS A . n A 1 119 LEU 119 194 194 LEU LEU A . n A 1 120 SER 120 195 195 SER SER A . n A 1 121 GLU 121 196 196 GLU GLU A . n A 1 122 TYR 122 197 197 TYR TYR A . n A 1 123 MSE 123 198 198 MSE MSE A . n A 1 124 LYS 124 199 199 LYS LYS A . n A 1 125 ALA 125 200 200 ALA ALA A . n A 1 126 LEU 126 201 201 LEU LEU A . n A 1 127 ILE 127 202 202 ILE ILE A . n A 1 128 ASN 128 203 203 ASN ASN A . n A 1 129 LYS 129 204 204 LYS LYS A . n A 1 130 LYS 130 205 205 LYS LYS A . n A 1 131 GLU 131 206 206 GLU GLU A . n A 1 132 LEU 132 207 207 LEU LEU A . n A 1 133 LEU 133 208 208 LEU LEU A . n A 1 134 SER 134 209 209 SER SER A . n A 1 135 GLU 135 210 210 GLU GLU A . n A 1 136 PHE 136 211 211 PHE PHE A . n A 1 137 TYR 137 212 212 TYR TYR A . n A 1 138 GLU 138 213 213 GLU GLU A . n A 1 139 VAL 139 214 214 VAL VAL A . n A 1 140 ASN 140 215 215 ASN ASN A . n A 1 141 ALA 141 216 216 ALA ALA A . n A 1 142 LEU 142 217 217 LEU LEU A . n A 1 143 MSE 143 218 218 MSE MSE A . n A 1 144 MSE 144 219 219 MSE MSE A . n A 1 145 GLU 145 220 220 GLU GLU A . n A 1 146 GLU 146 221 221 GLU GLU A . n A 1 147 GLU 147 222 222 GLU GLU A . n A 1 148 GLY 148 223 223 GLY GLY A . n A 1 149 ALA 149 224 224 ALA ALA A . n A 1 150 ILE 150 225 225 ILE ILE A . n A 1 151 ILE 151 226 226 ILE ILE A . n A 1 152 ALA 152 227 227 ALA ALA A . n A 1 153 GLY 153 228 228 GLY GLY A . n A 1 154 LEU 154 229 229 LEU LEU A . n A 1 155 LEU 155 230 230 LEU LEU A . n A 1 156 VAL 156 231 231 VAL VAL A . n A 1 157 GLY 157 232 232 GLY GLY A . n A 1 158 LEU 158 233 233 LEU LEU A . n A 1 159 ASN 159 234 234 ASN ASN A . n A 1 160 VAL 160 235 235 VAL VAL A . n A 1 161 ILE 161 236 236 ILE ILE A . n A 1 162 ASP 162 237 237 ASP ASP A . n A 1 163 ALA 163 238 238 ALA ALA A . n A 1 164 ASN 164 239 239 ASN ASN A . n A 1 165 PHE 165 240 240 PHE PHE A . n A 1 166 CYS 166 241 241 CYS CYS A . n A 1 167 MSE 167 242 242 MSE MSE A . n A 1 168 LYS 168 243 243 LYS LYS A . n A 1 169 GLY 169 244 244 GLY GLY A . n A 1 170 GLU 170 245 245 GLU GLU A . n A 1 171 ASP 171 246 246 ASP ASP A . n A 1 172 LEU 172 247 247 LEU LEU A . n A 1 173 ASP 173 248 ? ? ? A . n A 1 174 SER 174 249 ? ? ? A . n A 1 175 GLN 175 250 ? ? ? A . n A 1 176 VAL 176 251 ? ? ? A . n A 1 177 GLY 177 252 ? ? ? A . n A 1 178 VAL 178 253 ? ? ? A . n A 1 179 ILE 179 254 ? ? ? A . n A 1 180 ASP 180 255 ? ? ? A . n A 1 181 PHE 181 256 ? ? ? A . n A 1 182 SER 182 257 ? ? ? A . n A 1 183 MSE 183 258 ? ? ? A . n A 1 184 TYR 184 259 ? ? ? A . n A 1 185 LEU 185 260 ? ? ? A . n A 1 186 LYS 186 261 ? ? ? A . n A 1 187 ASP 187 262 ? ? ? A . n A 1 188 GLY 188 263 ? ? ? A . n A 1 189 ASN 189 264 ? ? ? A . n A 1 190 SER 190 265 ? ? ? A . n # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 HKL-2000 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 MOLREP phasing . ? 4 # _cell.entry_id 2CXL _cell.length_a 112.774 _cell.length_b 112.774 _cell.length_c 76.476 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 16 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2CXL _symmetry.space_group_name_H-M 'I 4 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 97 _symmetry.space_group_name_Hall ? # _exptl.entry_id 2CXL _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.91 _exptl_crystal.density_percent_sol 57.7 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'LIQUID DIFFUSION' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.6 _exptl_crystal_grow.pdbx_details 'PEG4000, Lithium Sulfate, Tris-HCl, pH 7.6, LIQUID DIFFUSION, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type ? _diffrn_detector.pdbx_collection_date 2005-05-16 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.97888 1.0 2 0.97951 1.0 3 0.97600 1.0 4 0.98300 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SPRING-8 BEAMLINE BL26B1' _diffrn_source.pdbx_synchrotron_site SPring-8 _diffrn_source.pdbx_synchrotron_beamline BL26B1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.97888, 0.97951, 0.97600, 0.98300' # _reflns.entry_id 2CXL _reflns.observed_criterion_sigma_I -3 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50 _reflns.d_resolution_high 3.18 _reflns.number_obs 4293 _reflns.number_all ? _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.11 _reflns.pdbx_netI_over_sigmaI 15.2776 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 10.0547 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 3.18 _reflns_shell.d_res_low 3.29 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.324 _reflns_shell.meanI_over_sigI_obs 5.51505 _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 2CXL _refine.ls_number_reflns_obs 4291 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 111601.45 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 42.10 _refine.ls_d_res_high 3.20 _refine.ls_percent_reflns_obs 99.8 _refine.ls_R_factor_obs 0.28 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.28 _refine.ls_R_factor_R_free 0.36 _refine.ls_R_factor_R_free_error 0.017 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.3 _refine.ls_number_reflns_R_free 444 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 52.1 _refine.aniso_B[1][1] 14.83 _refine.aniso_B[2][2] 14.83 _refine.aniso_B[3][3] -29.66 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.407703 _refine.solvent_model_param_bsol 123.806 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 1WUS' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2CXL _refine_analyze.Luzzati_coordinate_error_obs 0.42 _refine_analyze.Luzzati_sigma_a_obs 0.42 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.62 _refine_analyze.Luzzati_sigma_a_free 0.68 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1230 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1230 _refine_hist.d_res_high 3.20 _refine_hist.d_res_low 42.10 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.003 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 0.8 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 19.1 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.55 ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 3.18 _refine_ls_shell.d_res_low 3.38 _refine_ls_shell.number_reflns_R_work 559 _refine_ls_shell.R_factor_R_work 0.319 _refine_ls_shell.percent_reflns_obs 88.7 _refine_ls_shell.R_factor_R_free 0.446 _refine_ls_shell.R_factor_R_free_error 0.056 _refine_ls_shell.percent_reflns_R_free 10.1 _refine_ls_shell.number_reflns_R_free 63 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _pdbx_xplor_file.serial_no 1 _pdbx_xplor_file.param_file protein_rep.param _pdbx_xplor_file.topol_file protein.top _pdbx_xplor_file.pdbx_refine_id 'X-RAY DIFFRACTION' # _database_PDB_matrix.entry_id 2CXL _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2CXL _struct.title 'RUN domain of Rap2 interacting protein x, crystallized in I422 space group' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CXL _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text ;RUN domain, helix bundle, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9D394_MOUSE _struct_ref.pdbx_db_accession Q9D394 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKAKKTFLGQNKSFWGPLELVEKLVPEAA EITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYMKALINKKELLSEFYEVNALMMEEEGAIIAGLLVGLNVIDANFCM KGEDLDSQVGVIDFSMYLKDGNS ; _struct_ref.pdbx_align_begin 65 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CXL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 190 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9D394 _struct_ref_seq.db_align_beg 65 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 247 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 83 _struct_ref_seq.pdbx_auth_seq_align_end 265 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2CXL GLY A 1 ? UNP Q9D394 ? ? 'cloning artifact' 76 1 1 2CXL SER A 2 ? UNP Q9D394 ? ? 'cloning artifact' 77 2 1 2CXL SER A 3 ? UNP Q9D394 ? ? 'cloning artifact' 78 3 1 2CXL GLY A 4 ? UNP Q9D394 ? ? 'cloning artifact' 79 4 1 2CXL SER A 5 ? UNP Q9D394 ? ? 'cloning artifact' 80 5 1 2CXL SER A 6 ? UNP Q9D394 ? ? 'cloning artifact' 81 6 1 2CXL GLY A 7 ? UNP Q9D394 ? ? 'cloning artifact' 82 7 1 2CXL MSE A 8 ? UNP Q9D394 MET 65 'modified residue' 83 8 1 2CXL MSE A 13 ? UNP Q9D394 MET 70 'modified residue' 88 9 1 2CXL MSE A 16 ? UNP Q9D394 MET 73 'modified residue' 91 10 1 2CXL MSE A 18 ? UNP Q9D394 MET 75 'modified residue' 93 11 1 2CXL MSE A 51 ? UNP Q9D394 MET 108 'modified residue' 126 12 1 2CXL MSE A 115 ? UNP Q9D394 MET 172 'modified residue' 190 13 1 2CXL MSE A 123 ? UNP Q9D394 MET 180 'modified residue' 198 14 1 2CXL MSE A 143 ? UNP Q9D394 MET 200 'modified residue' 218 15 1 2CXL MSE A 144 ? UNP Q9D394 MET 201 'modified residue' 219 16 1 2CXL MSE A 167 ? UNP Q9D394 MET 224 'modified residue' 242 17 1 2CXL MSE A 183 ? UNP Q9D394 MET 240 'modified residue' 258 18 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 9 ? MSE A 18 ? ALA A 84 MSE A 93 1 ? 10 HELX_P HELX_P2 2 ALA A 19 ? GLY A 34 ? ALA A 94 GLY A 109 1 ? 16 HELX_P HELX_P3 3 TYR A 41 ? HIS A 57 ? TYR A 116 HIS A 132 1 ? 17 HELX_P HELX_P4 4 PHE A 72 ? GLU A 77 ? PHE A 147 GLU A 152 1 ? 6 HELX_P HELX_P5 5 LEU A 78 ? VAL A 83 ? LEU A 153 VAL A 158 1 ? 6 HELX_P HELX_P6 6 ALA A 86 ? VAL A 93 ? ALA A 161 VAL A 168 1 ? 8 HELX_P HELX_P7 7 THR A 101 ? LYS A 117 ? THR A 176 LYS A 192 1 ? 17 HELX_P HELX_P8 8 LYS A 118 ? ASN A 128 ? LYS A 193 ASN A 203 1 ? 11 HELX_P HELX_P9 9 LYS A 129 ? SER A 134 ? LYS A 204 SER A 209 1 ? 6 HELX_P HELX_P10 10 ALA A 141 ? GLU A 145 ? ALA A 216 GLU A 220 5 ? 5 HELX_P HELX_P11 11 GLU A 146 ? LEU A 155 ? GLU A 221 LEU A 230 1 ? 10 HELX_P HELX_P12 12 VAL A 156 ? ILE A 161 ? VAL A 231 ILE A 236 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A MSE 8 C ? ? ? 1_555 A ALA 9 N ? ? A MSE 83 A ALA 84 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale2 covale both ? A ARG 12 C ? ? ? 1_555 A MSE 13 N ? ? A ARG 87 A MSE 88 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale3 covale both ? A MSE 13 C ? ? ? 1_555 A ASN 14 N ? ? A MSE 88 A ASN 89 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale4 covale both ? A LEU 15 C ? ? ? 1_555 A MSE 16 N ? ? A LEU 90 A MSE 91 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale5 covale both ? A MSE 16 C ? ? ? 1_555 A ASN 17 N ? ? A MSE 91 A ASN 92 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale6 covale both ? A ASN 17 C ? ? ? 1_555 A MSE 18 N ? ? A ASN 92 A MSE 93 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale7 covale both ? A MSE 18 C ? ? ? 1_555 A ALA 19 N ? ? A MSE 93 A ALA 94 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale8 covale both ? A VAL 50 C ? ? ? 1_555 A MSE 51 N ? ? A VAL 125 A MSE 126 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale9 covale both ? A MSE 51 C ? ? ? 1_555 A GLU 52 N ? ? A MSE 126 A GLU 127 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale10 covale both ? A LEU 114 C ? ? ? 1_555 A MSE 115 N ? ? A LEU 189 A MSE 190 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale11 covale both ? A MSE 115 C ? ? ? 1_555 A GLN 116 N ? ? A MSE 190 A GLN 191 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale12 covale both ? A TYR 122 C ? ? ? 1_555 A MSE 123 N ? ? A TYR 197 A MSE 198 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale13 covale both ? A MSE 123 C ? ? ? 1_555 A LYS 124 N ? ? A MSE 198 A LYS 199 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale14 covale both ? A LEU 142 C ? ? ? 1_555 A MSE 143 N ? ? A LEU 217 A MSE 218 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale15 covale both ? A MSE 143 C ? ? ? 1_555 A MSE 144 N ? ? A MSE 218 A MSE 219 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale16 covale both ? A MSE 144 C ? ? ? 1_555 A GLU 145 N ? ? A MSE 219 A GLU 220 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale17 covale both ? A CYS 166 C ? ? ? 1_555 A MSE 167 N ? ? A CYS 241 A MSE 242 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale18 covale both ? A MSE 167 C ? ? ? 1_555 A LYS 168 N ? ? A MSE 242 A LYS 243 1_555 ? ? ? ? ? ? ? 1.332 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 8 ? . . . . MSE A 83 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 13 ? . . . . MSE A 88 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 16 ? . . . . MSE A 91 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 4 MSE A 18 ? . . . . MSE A 93 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 5 MSE A 51 ? . . . . MSE A 126 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 6 MSE A 115 ? . . . . MSE A 190 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 7 MSE A 123 ? . . . . MSE A 198 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 8 MSE A 143 ? . . . . MSE A 218 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 9 MSE A 144 ? . . . . MSE A 219 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 10 MSE A 167 ? . . . . MSE A 242 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 37 ? ASP A 38 ? LEU A 112 ASP A 113 A 2 ALA A 163 ? ASN A 164 ? ALA A 238 ASN A 239 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LEU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 37 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 112 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ASN _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 164 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ASN _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 239 # _pdbx_entry_details.entry_id 2CXL _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 115 ? ? -74.51 28.22 2 1 LYS A 135 ? ? -108.35 -150.54 3 1 SER A 146 ? ? 49.34 -129.76 4 1 LYS A 175 ? ? -78.20 -90.80 5 1 THR A 176 ? ? -36.37 148.25 6 1 GLU A 206 ? ? -64.31 4.29 7 1 SER A 209 ? ? -51.53 -9.00 8 1 LYS A 243 ? ? 174.58 166.91 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 8 A MSE 83 ? MET SELENOMETHIONINE 2 A MSE 13 A MSE 88 ? MET SELENOMETHIONINE 3 A MSE 16 A MSE 91 ? MET SELENOMETHIONINE 4 A MSE 18 A MSE 93 ? MET SELENOMETHIONINE 5 A MSE 51 A MSE 126 ? MET SELENOMETHIONINE 6 A MSE 115 A MSE 190 ? MET SELENOMETHIONINE 7 A MSE 123 A MSE 198 ? MET SELENOMETHIONINE 8 A MSE 143 A MSE 218 ? MET SELENOMETHIONINE 9 A MSE 144 A MSE 219 ? MET SELENOMETHIONINE 10 A MSE 167 A MSE 242 ? MET SELENOMETHIONINE # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 76 ? A GLY 1 2 1 Y 1 A SER 77 ? A SER 2 3 1 Y 1 A SER 78 ? A SER 3 4 1 Y 1 A GLY 79 ? A GLY 4 5 1 Y 1 A SER 80 ? A SER 5 6 1 Y 1 A SER 81 ? A SER 6 7 1 Y 1 A GLY 82 ? A GLY 7 8 1 Y 1 A LYS 137 ? A LYS 62 9 1 Y 1 A LYS 138 ? A LYS 63 10 1 Y 1 A THR 139 ? A THR 64 11 1 Y 1 A PHE 140 ? A PHE 65 12 1 Y 1 A LEU 141 ? A LEU 66 13 1 Y 1 A GLY 142 ? A GLY 67 14 1 Y 1 A GLN 143 ? A GLN 68 15 1 Y 1 A ASP 248 ? A ASP 173 16 1 Y 1 A SER 249 ? A SER 174 17 1 Y 1 A GLN 250 ? A GLN 175 18 1 Y 1 A VAL 251 ? A VAL 176 19 1 Y 1 A GLY 252 ? A GLY 177 20 1 Y 1 A VAL 253 ? A VAL 178 21 1 Y 1 A ILE 254 ? A ILE 179 22 1 Y 1 A ASP 255 ? A ASP 180 23 1 Y 1 A PHE 256 ? A PHE 181 24 1 Y 1 A SER 257 ? A SER 182 25 1 Y 1 A MSE 258 ? A MSE 183 26 1 Y 1 A TYR 259 ? A TYR 184 27 1 Y 1 A LEU 260 ? A LEU 185 28 1 Y 1 A LYS 261 ? A LYS 186 29 1 Y 1 A ASP 262 ? A ASP 187 30 1 Y 1 A GLY 263 ? A GLY 188 31 1 Y 1 A ASN 264 ? A ASN 189 32 1 Y 1 A SER 265 ? A SER 190 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 MSE N N N N 247 MSE CA C N S 248 MSE C C N N 249 MSE O O N N 250 MSE OXT O N N 251 MSE CB C N N 252 MSE CG C N N 253 MSE SE SE N N 254 MSE CE C N N 255 MSE H H N N 256 MSE H2 H N N 257 MSE HA H N N 258 MSE HXT H N N 259 MSE HB2 H N N 260 MSE HB3 H N N 261 MSE HG2 H N N 262 MSE HG3 H N N 263 MSE HE1 H N N 264 MSE HE2 H N N 265 MSE HE3 H N N 266 PHE N N N N 267 PHE CA C N S 268 PHE C C N N 269 PHE O O N N 270 PHE CB C N N 271 PHE CG C Y N 272 PHE CD1 C Y N 273 PHE CD2 C Y N 274 PHE CE1 C Y N 275 PHE CE2 C Y N 276 PHE CZ C Y N 277 PHE OXT O N N 278 PHE H H N N 279 PHE H2 H N N 280 PHE HA H N N 281 PHE HB2 H N N 282 PHE HB3 H N N 283 PHE HD1 H N N 284 PHE HD2 H N N 285 PHE HE1 H N N 286 PHE HE2 H N N 287 PHE HZ H N N 288 PHE HXT H N N 289 PRO N N N N 290 PRO CA C N S 291 PRO C C N N 292 PRO O O N N 293 PRO CB C N N 294 PRO CG C N N 295 PRO CD C N N 296 PRO OXT O N N 297 PRO H H N N 298 PRO HA H N N 299 PRO HB2 H N N 300 PRO HB3 H N N 301 PRO HG2 H N N 302 PRO HG3 H N N 303 PRO HD2 H N N 304 PRO HD3 H N N 305 PRO HXT H N N 306 SER N N N N 307 SER CA C N S 308 SER C C N N 309 SER O O N N 310 SER CB C N N 311 SER OG O N N 312 SER OXT O N N 313 SER H H N N 314 SER H2 H N N 315 SER HA H N N 316 SER HB2 H N N 317 SER HB3 H N N 318 SER HG H N N 319 SER HXT H N N 320 THR N N N N 321 THR CA C N S 322 THR C C N N 323 THR O O N N 324 THR CB C N R 325 THR OG1 O N N 326 THR CG2 C N N 327 THR OXT O N N 328 THR H H N N 329 THR H2 H N N 330 THR HA H N N 331 THR HB H N N 332 THR HG1 H N N 333 THR HG21 H N N 334 THR HG22 H N N 335 THR HG23 H N N 336 THR HXT H N N 337 TRP N N N N 338 TRP CA C N S 339 TRP C C N N 340 TRP O O N N 341 TRP CB C N N 342 TRP CG C Y N 343 TRP CD1 C Y N 344 TRP CD2 C Y N 345 TRP NE1 N Y N 346 TRP CE2 C Y N 347 TRP CE3 C Y N 348 TRP CZ2 C Y N 349 TRP CZ3 C Y N 350 TRP CH2 C Y N 351 TRP OXT O N N 352 TRP H H N N 353 TRP H2 H N N 354 TRP HA H N N 355 TRP HB2 H N N 356 TRP HB3 H N N 357 TRP HD1 H N N 358 TRP HE1 H N N 359 TRP HE3 H N N 360 TRP HZ2 H N N 361 TRP HZ3 H N N 362 TRP HH2 H N N 363 TRP HXT H N N 364 TYR N N N N 365 TYR CA C N S 366 TYR C C N N 367 TYR O O N N 368 TYR CB C N N 369 TYR CG C Y N 370 TYR CD1 C Y N 371 TYR CD2 C Y N 372 TYR CE1 C Y N 373 TYR CE2 C Y N 374 TYR CZ C Y N 375 TYR OH O N N 376 TYR OXT O N N 377 TYR H H N N 378 TYR H2 H N N 379 TYR HA H N N 380 TYR HB2 H N N 381 TYR HB3 H N N 382 TYR HD1 H N N 383 TYR HD2 H N N 384 TYR HE1 H N N 385 TYR HE2 H N N 386 TYR HH H N N 387 TYR HXT H N N 388 VAL N N N N 389 VAL CA C N S 390 VAL C C N N 391 VAL O O N N 392 VAL CB C N N 393 VAL CG1 C N N 394 VAL CG2 C N N 395 VAL OXT O N N 396 VAL H H N N 397 VAL H2 H N N 398 VAL HA H N N 399 VAL HB H N N 400 VAL HG11 H N N 401 VAL HG12 H N N 402 VAL HG13 H N N 403 VAL HG21 H N N 404 VAL HG22 H N N 405 VAL HG23 H N N 406 VAL HXT H N N 407 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 MSE N CA sing N N 235 MSE N H sing N N 236 MSE N H2 sing N N 237 MSE CA C sing N N 238 MSE CA CB sing N N 239 MSE CA HA sing N N 240 MSE C O doub N N 241 MSE C OXT sing N N 242 MSE OXT HXT sing N N 243 MSE CB CG sing N N 244 MSE CB HB2 sing N N 245 MSE CB HB3 sing N N 246 MSE CG SE sing N N 247 MSE CG HG2 sing N N 248 MSE CG HG3 sing N N 249 MSE SE CE sing N N 250 MSE CE HE1 sing N N 251 MSE CE HE2 sing N N 252 MSE CE HE3 sing N N 253 PHE N CA sing N N 254 PHE N H sing N N 255 PHE N H2 sing N N 256 PHE CA C sing N N 257 PHE CA CB sing N N 258 PHE CA HA sing N N 259 PHE C O doub N N 260 PHE C OXT sing N N 261 PHE CB CG sing N N 262 PHE CB HB2 sing N N 263 PHE CB HB3 sing N N 264 PHE CG CD1 doub Y N 265 PHE CG CD2 sing Y N 266 PHE CD1 CE1 sing Y N 267 PHE CD1 HD1 sing N N 268 PHE CD2 CE2 doub Y N 269 PHE CD2 HD2 sing N N 270 PHE CE1 CZ doub Y N 271 PHE CE1 HE1 sing N N 272 PHE CE2 CZ sing Y N 273 PHE CE2 HE2 sing N N 274 PHE CZ HZ sing N N 275 PHE OXT HXT sing N N 276 PRO N CA sing N N 277 PRO N CD sing N N 278 PRO N H sing N N 279 PRO CA C sing N N 280 PRO CA CB sing N N 281 PRO CA HA sing N N 282 PRO C O doub N N 283 PRO C OXT sing N N 284 PRO CB CG sing N N 285 PRO CB HB2 sing N N 286 PRO CB HB3 sing N N 287 PRO CG CD sing N N 288 PRO CG HG2 sing N N 289 PRO CG HG3 sing N N 290 PRO CD HD2 sing N N 291 PRO CD HD3 sing N N 292 PRO OXT HXT sing N N 293 SER N CA sing N N 294 SER N H sing N N 295 SER N H2 sing N N 296 SER CA C sing N N 297 SER CA CB sing N N 298 SER CA HA sing N N 299 SER C O doub N N 300 SER C OXT sing N N 301 SER CB OG sing N N 302 SER CB HB2 sing N N 303 SER CB HB3 sing N N 304 SER OG HG sing N N 305 SER OXT HXT sing N N 306 THR N CA sing N N 307 THR N H sing N N 308 THR N H2 sing N N 309 THR CA C sing N N 310 THR CA CB sing N N 311 THR CA HA sing N N 312 THR C O doub N N 313 THR C OXT sing N N 314 THR CB OG1 sing N N 315 THR CB CG2 sing N N 316 THR CB HB sing N N 317 THR OG1 HG1 sing N N 318 THR CG2 HG21 sing N N 319 THR CG2 HG22 sing N N 320 THR CG2 HG23 sing N N 321 THR OXT HXT sing N N 322 TRP N CA sing N N 323 TRP N H sing N N 324 TRP N H2 sing N N 325 TRP CA C sing N N 326 TRP CA CB sing N N 327 TRP CA HA sing N N 328 TRP C O doub N N 329 TRP C OXT sing N N 330 TRP CB CG sing N N 331 TRP CB HB2 sing N N 332 TRP CB HB3 sing N N 333 TRP CG CD1 doub Y N 334 TRP CG CD2 sing Y N 335 TRP CD1 NE1 sing Y N 336 TRP CD1 HD1 sing N N 337 TRP CD2 CE2 doub Y N 338 TRP CD2 CE3 sing Y N 339 TRP NE1 CE2 sing Y N 340 TRP NE1 HE1 sing N N 341 TRP CE2 CZ2 sing Y N 342 TRP CE3 CZ3 doub Y N 343 TRP CE3 HE3 sing N N 344 TRP CZ2 CH2 doub Y N 345 TRP CZ2 HZ2 sing N N 346 TRP CZ3 CH2 sing Y N 347 TRP CZ3 HZ3 sing N N 348 TRP CH2 HH2 sing N N 349 TRP OXT HXT sing N N 350 TYR N CA sing N N 351 TYR N H sing N N 352 TYR N H2 sing N N 353 TYR CA C sing N N 354 TYR CA CB sing N N 355 TYR CA HA sing N N 356 TYR C O doub N N 357 TYR C OXT sing N N 358 TYR CB CG sing N N 359 TYR CB HB2 sing N N 360 TYR CB HB3 sing N N 361 TYR CG CD1 doub Y N 362 TYR CG CD2 sing Y N 363 TYR CD1 CE1 sing Y N 364 TYR CD1 HD1 sing N N 365 TYR CD2 CE2 doub Y N 366 TYR CD2 HD2 sing N N 367 TYR CE1 CZ doub Y N 368 TYR CE1 HE1 sing N N 369 TYR CE2 CZ sing Y N 370 TYR CE2 HE2 sing N N 371 TYR CZ OH sing N N 372 TYR OH HH sing N N 373 TYR OXT HXT sing N N 374 VAL N CA sing N N 375 VAL N H sing N N 376 VAL N H2 sing N N 377 VAL CA C sing N N 378 VAL CA CB sing N N 379 VAL CA HA sing N N 380 VAL C O doub N N 381 VAL C OXT sing N N 382 VAL CB CG1 sing N N 383 VAL CB CG2 sing N N 384 VAL CB HB sing N N 385 VAL CG1 HG11 sing N N 386 VAL CG1 HG12 sing N N 387 VAL CG1 HG13 sing N N 388 VAL CG2 HG21 sing N N 389 VAL CG2 HG22 sing N N 390 VAL CG2 HG23 sing N N 391 VAL OXT HXT sing N N 392 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1WUS _pdbx_initial_refinement_model.details 'PDB ENTRY 1WUS' # _atom_sites.entry_id 2CXL _atom_sites.fract_transf_matrix[1][1] 0.008867 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008867 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013076 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_