data_2D49 # _entry.id 2D49 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2D49 pdb_00002d49 10.2210/pdb2d49/pdb RCSB RCSB024967 ? ? WWPDB D_1000024967 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2D49 _pdbx_database_status.recvd_initial_deposition_date 2005-10-11 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Akagi, K.' 1 'Watanabe, J.' 2 'Hara, M.' 3 'Kezuka, Y.' 4 'Chikaishi, E.' 5 'Yamaguchi, T.' 6 'Akutsu, H.' 7 'Nonaka, T.' 8 'Watanabe, T.' 9 'Ikegami, T.' 10 # _citation.id primary _citation.title 'Identification of the substrate interaction region of the chitin-binding domain of Streptomyces griseus chitinase C' _citation.journal_abbrev 'J.Biochem.(Tokyo)' _citation.journal_volume 139 _citation.page_first 483 _citation.page_last 493 _citation.year 2006 _citation.journal_id_ASTM JOBIAO _citation.country JA _citation.journal_id_ISSN 0021-924X _citation.journal_id_CSD 0418 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16567413 _citation.pdbx_database_id_DOI 10.1093/jb/mvj062 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Akagi, K.' 1 ? primary 'Watanabe, J.' 2 ? primary 'Hara, M.' 3 ? primary 'Kezuka, Y.' 4 ? primary 'Chikaishi, E.' 5 ? primary 'Yamaguchi, T.' 6 ? primary 'Akutsu, H.' 7 ? primary 'Nonaka, T.' 8 ? primary 'Watanabe, T.' 9 ? primary 'Ikegami, T.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'chitinase C' _entity.formula_weight 5613.948 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.2.1.14 _entity.pdbx_mutation G82S _entity.pdbx_fragment 'Chitin Binding Domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ATCATAWSSSSVYTNGGTVSYNGRNYTAKWWTQNERPGTSDVWADKGACGTGS _entity_poly.pdbx_seq_one_letter_code_can ATCATAWSSSSVYTNGGTVSYNGRNYTAKWWTQNERPGTSDVWADKGACGTGS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 THR n 1 3 CYS n 1 4 ALA n 1 5 THR n 1 6 ALA n 1 7 TRP n 1 8 SER n 1 9 SER n 1 10 SER n 1 11 SER n 1 12 VAL n 1 13 TYR n 1 14 THR n 1 15 ASN n 1 16 GLY n 1 17 GLY n 1 18 THR n 1 19 VAL n 1 20 SER n 1 21 TYR n 1 22 ASN n 1 23 GLY n 1 24 ARG n 1 25 ASN n 1 26 TYR n 1 27 THR n 1 28 ALA n 1 29 LYS n 1 30 TRP n 1 31 TRP n 1 32 THR n 1 33 GLN n 1 34 ASN n 1 35 GLU n 1 36 ARG n 1 37 PRO n 1 38 GLY n 1 39 THR n 1 40 SER n 1 41 ASP n 1 42 VAL n 1 43 TRP n 1 44 ALA n 1 45 ASP n 1 46 LYS n 1 47 GLY n 1 48 ALA n 1 49 CYS n 1 50 GLY n 1 51 THR n 1 52 GLY n 1 53 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Streptomyces _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces griseus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1911 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET22b(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O50152_STRGR _struct_ref.pdbx_db_accession O50152 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 30 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2D49 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 53 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O50152 _struct_ref_seq.db_align_beg 30 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 82 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 53 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2D49 _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 53 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O50152 _struct_ref_seq_dif.db_mon_id GLY _struct_ref_seq_dif.pdbx_seq_db_seq_num 82 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 53 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 6 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents 'Napi 20mM DTT 1mM NaN, 0.02%(w/w); 90% H2O, 100% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O, 100% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AV, DRX' _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 400 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_ensemble.entry_id 2D49 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 30 _pdbx_nmr_ensemble.conformer_selection_criteria ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2D49 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CYANA 2.1 ? 1 'structure solution' CYANA 2.1 ? 2 # _exptl.entry_id 2D49 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2D49 _struct.title 'Solution structure of the Chitin-Binding Domain of Streptomyces griseus Chitinase C' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2D49 _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'chitinase, chitin binding domain, ChBD, HYDROLASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 3 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 49 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 3 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 49 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.962 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 18 ? TYR A 21 ? THR A 18 TYR A 21 A 2 ARG A 24 ? THR A 27 ? ARG A 24 THR A 27 A 3 ALA A 44 ? ALA A 48 ? ALA A 44 ALA A 48 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 19 ? N VAL A 19 O TYR A 26 ? O TYR A 26 A 2 3 N ASN A 25 ? N ASN A 25 O LYS A 46 ? O LYS A 46 # _database_PDB_matrix.entry_id 2D49 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2D49 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 TRP 7 7 7 TRP TRP A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 TRP 30 30 30 TRP TRP A . n A 1 31 TRP 31 31 31 TRP TRP A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 TRP 43 43 43 TRP TRP A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 SER 53 53 53 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-10-11 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 3 ? ? -176.84 122.16 2 1 TYR A 21 ? ? -177.07 140.73 3 1 ASN A 34 ? ? -49.11 104.27 4 2 CYS A 3 ? ? -179.40 147.55 5 2 TYR A 21 ? ? -177.08 138.00 6 2 ASN A 34 ? ? -50.00 103.92 7 3 CYS A 3 ? ? -179.37 145.87 8 3 TYR A 21 ? ? -177.06 137.47 9 3 ASN A 34 ? ? -50.32 103.51 10 4 CYS A 3 ? ? -177.56 120.38 11 4 TYR A 21 ? ? -177.07 139.10 12 4 ASN A 34 ? ? -49.74 104.09 13 5 CYS A 3 ? ? -177.48 120.72 14 5 TYR A 21 ? ? -177.10 138.81 15 5 ASN A 34 ? ? -49.82 103.99 16 6 CYS A 3 ? ? -179.41 144.97 17 6 TYR A 21 ? ? -177.08 137.61 18 6 ASN A 34 ? ? -49.65 103.95 19 7 CYS A 3 ? ? -177.48 118.33 20 7 TYR A 21 ? ? -177.05 138.86 21 7 ASN A 34 ? ? -49.18 104.26 22 8 CYS A 3 ? ? -177.53 119.60 23 8 TYR A 21 ? ? -177.08 138.78 24 8 ASN A 34 ? ? -48.82 104.32 25 9 CYS A 3 ? ? -177.37 125.40 26 9 SER A 11 ? ? -160.23 118.71 27 9 TYR A 21 ? ? -177.05 138.87 28 9 ASN A 34 ? ? -50.42 103.43 29 10 CYS A 3 ? ? -177.43 119.58 30 10 TYR A 21 ? ? -177.07 140.30 31 10 ASN A 34 ? ? -48.89 104.21 32 11 CYS A 3 ? ? -177.27 122.82 33 11 TYR A 21 ? ? -177.04 138.80 34 11 ASN A 34 ? ? -48.43 104.59 35 12 CYS A 3 ? ? -179.37 146.40 36 12 TYR A 21 ? ? -177.12 137.86 37 12 TRP A 30 ? ? -179.19 -175.47 38 12 ASN A 34 ? ? -48.05 104.78 39 13 CYS A 3 ? ? -177.61 128.74 40 13 TYR A 21 ? ? -177.07 138.76 41 13 ASN A 34 ? ? -49.81 103.73 42 14 CYS A 3 ? ? -174.41 144.15 43 14 TYR A 21 ? ? -177.15 136.21 44 14 ASN A 34 ? ? -50.18 103.24 45 15 CYS A 3 ? ? -177.37 125.12 46 15 TYR A 21 ? ? -177.10 138.90 47 15 ASN A 34 ? ? -51.58 102.63 48 16 CYS A 3 ? ? -176.86 120.59 49 16 TYR A 21 ? ? -177.02 140.02 50 16 ASN A 34 ? ? -49.56 103.84 51 17 CYS A 3 ? ? -177.40 125.61 52 17 TYR A 21 ? ? -177.08 138.87 53 17 ASN A 34 ? ? -49.64 103.78 54 18 CYS A 3 ? ? -176.53 121.66 55 18 TYR A 21 ? ? -177.08 140.53 56 18 ASN A 34 ? ? -49.34 103.93 57 19 CYS A 3 ? ? -176.07 143.19 58 19 TYR A 21 ? ? -177.12 138.18 59 19 ASN A 34 ? ? -51.68 102.56 60 20 CYS A 3 ? ? -179.34 149.86 61 20 TYR A 21 ? ? -177.09 141.37 62 20 ASN A 34 ? ? -49.31 103.88 63 21 CYS A 3 ? ? -176.62 142.02 64 21 TYR A 21 ? ? -177.12 137.87 65 21 ASN A 34 ? ? -49.64 103.53 66 22 CYS A 3 ? ? -179.57 142.61 67 22 TYR A 21 ? ? -176.79 135.77 68 22 ASN A 34 ? ? -47.29 105.19 69 23 TYR A 21 ? ? -177.05 136.41 70 23 ASN A 34 ? ? -49.48 104.11 71 24 CYS A 3 ? ? -176.13 133.92 72 24 TYR A 21 ? ? -177.15 143.86 73 24 ASN A 34 ? ? -48.91 104.62 74 25 CYS A 3 ? ? -176.34 121.96 75 25 TYR A 21 ? ? -177.01 141.15 76 25 ASN A 34 ? ? -49.09 104.16 77 26 CYS A 3 ? ? -177.59 140.97 78 26 TYR A 21 ? ? -177.17 138.41 79 26 TRP A 30 ? ? -170.27 -175.49 80 26 ASN A 34 ? ? -49.33 103.76 81 27 CYS A 3 ? ? -177.28 123.74 82 27 TYR A 21 ? ? -177.09 139.27 83 27 ASN A 34 ? ? -49.45 103.81 84 28 CYS A 3 ? ? -179.54 145.18 85 28 TYR A 21 ? ? -177.05 137.84 86 28 ASN A 34 ? ? -49.33 103.73 87 29 TYR A 21 ? ? -177.08 136.24 88 29 ASN A 34 ? ? -50.34 103.06 89 30 CYS A 3 ? ? -176.68 123.36 90 30 TYR A 21 ? ? -177.03 139.17 91 30 TRP A 30 ? ? -179.30 -175.27 92 30 ASN A 34 ? ? -48.90 103.93 #