data_2D8H # _entry.id 2D8H # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2D8H pdb_00002d8h 10.2210/pdb2d8h/pdb RCSB RCSB025118 ? ? WWPDB D_1000025118 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002007134.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2D8H _pdbx_database_status.recvd_initial_deposition_date 2005-12-06 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Qin, X.R.' 1 'Nagasima, T.' 2 'Hayashi, F.' 3 'Yokoyama, S.' 4 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 # _citation.id primary _citation.title 'Solution structure of the SH3 domain of Hypothetical protein SH3YL1' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Qin, X.R.' 1 ? primary 'Nagasima, T.' 2 ? primary 'Hayashi, F.' 3 ? primary 'Yokoyama, S.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'SH3YL1 protein' _entity.formula_weight 8595.269 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SH3 domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGHERVGNLNQPIEVTALYSFEGQQPGDLNFQAGDRITVISKTDSHFDWWEGKLRGQTGIFPANYVTMNSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGHERVGNLNQPIEVTALYSFEGQQPGDLNFQAGDRITVISKTDSHFDWWEGKLRGQTGIFPANYVTMNSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002007134.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 HIS n 1 9 GLU n 1 10 ARG n 1 11 VAL n 1 12 GLY n 1 13 ASN n 1 14 LEU n 1 15 ASN n 1 16 GLN n 1 17 PRO n 1 18 ILE n 1 19 GLU n 1 20 VAL n 1 21 THR n 1 22 ALA n 1 23 LEU n 1 24 TYR n 1 25 SER n 1 26 PHE n 1 27 GLU n 1 28 GLY n 1 29 GLN n 1 30 GLN n 1 31 PRO n 1 32 GLY n 1 33 ASP n 1 34 LEU n 1 35 ASN n 1 36 PHE n 1 37 GLN n 1 38 ALA n 1 39 GLY n 1 40 ASP n 1 41 ARG n 1 42 ILE n 1 43 THR n 1 44 VAL n 1 45 ILE n 1 46 SER n 1 47 LYS n 1 48 THR n 1 49 ASP n 1 50 SER n 1 51 HIS n 1 52 PHE n 1 53 ASP n 1 54 TRP n 1 55 TRP n 1 56 GLU n 1 57 GLY n 1 58 LYS n 1 59 LEU n 1 60 ARG n 1 61 GLY n 1 62 GLN n 1 63 THR n 1 64 GLY n 1 65 ILE n 1 66 PHE n 1 67 PRO n 1 68 ALA n 1 69 ASN n 1 70 TYR n 1 71 VAL n 1 72 THR n 1 73 MET n 1 74 ASN n 1 75 SER n 1 76 GLY n 1 77 PRO n 1 78 SER n 1 79 SER n 1 80 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene SH3YL1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050425-18 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name GB _struct_ref.db_code AAH08374 _struct_ref.pdbx_db_accession 14249975 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code HERVGNLNQPIEVTALYSFEGQQPGDLNFQAGDRITVISKTDSHFDWWEGKLRGQTGIFPANYVTMN _struct_ref.pdbx_align_begin 276 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2D8H _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 74 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 14249975 _struct_ref_seq.db_align_beg 276 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 342 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 74 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2D8H GLY A 1 ? GB 14249975 ? ? 'cloning artifact' 1 1 1 2D8H SER A 2 ? GB 14249975 ? ? 'cloning artifact' 2 2 1 2D8H SER A 3 ? GB 14249975 ? ? 'cloning artifact' 3 3 1 2D8H GLY A 4 ? GB 14249975 ? ? 'cloning artifact' 4 4 1 2D8H SER A 5 ? GB 14249975 ? ? 'cloning artifact' 5 5 1 2D8H SER A 6 ? GB 14249975 ? ? 'cloning artifact' 6 6 1 2D8H GLY A 7 ? GB 14249975 ? ? 'cloning artifact' 7 7 1 2D8H SER A 75 ? GB 14249975 ? ? 'cloning artifact' 75 8 1 2D8H GLY A 76 ? GB 14249975 ? ? 'cloning artifact' 76 9 1 2D8H PRO A 77 ? GB 14249975 ? ? 'cloning artifact' 77 10 1 2D8H SER A 78 ? GB 14249975 ? ? 'cloning artifact' 78 11 1 2D8H SER A 79 ? GB 14249975 ? ? 'cloning artifact' 79 12 1 2D8H GLY A 80 ? GB 14249975 ? ? 'cloning artifact' 80 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.19mM 13C,15N-labeled protein; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2D8H _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2D8H _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function,structures with the lowest energy,structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2D8H _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9296 'Kobayashi, N' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2D8H _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2D8H _struct.title 'Solution structure of the SH3 domain of Hypothetical protein SH3YL1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2D8H _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' _struct_keywords.text ;SH3 domain, Hypothetical protein SH3YL1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 69 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id VAL _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 71 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 69 _struct_conf.end_auth_comp_id VAL _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 71 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 18 ? THR A 21 ? ILE A 18 THR A 21 A 2 ARG A 41 ? SER A 46 ? ARG A 41 SER A 46 A 3 TRP A 54 ? LEU A 59 ? TRP A 54 LEU A 59 A 4 GLN A 62 ? PRO A 67 ? GLN A 62 PRO A 67 B 1 PHE A 26 ? GLU A 27 ? PHE A 26 GLU A 27 B 2 ASN A 35 ? PHE A 36 ? ASN A 35 PHE A 36 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 18 ? N ILE A 18 O VAL A 44 ? O VAL A 44 A 2 3 N THR A 43 ? N THR A 43 O LYS A 58 ? O LYS A 58 A 3 4 N TRP A 55 ? N TRP A 55 O PHE A 66 ? O PHE A 66 B 1 2 N PHE A 26 ? N PHE A 26 O PHE A 36 ? O PHE A 36 # _database_PDB_matrix.entry_id 2D8H _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2D8H _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 TRP 54 54 54 TRP TRP A . n A 1 55 TRP 55 55 55 TRP TRP A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 MET 73 73 73 MET MET A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 GLY 80 80 80 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-06-06 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 17 ? ? -69.78 -178.51 2 1 ALA A 38 ? ? -45.09 105.05 3 1 ASP A 49 ? ? -89.40 44.36 4 1 PHE A 52 ? ? -89.51 46.84 5 2 GLU A 9 ? ? -54.80 100.90 6 2 PRO A 17 ? ? -69.73 -175.09 7 2 ALA A 38 ? ? -52.67 103.15 8 2 ASP A 53 ? ? -42.92 155.80 9 2 PRO A 77 ? ? -69.74 86.75 10 3 PRO A 17 ? ? -69.76 -179.41 11 3 PRO A 31 ? ? -69.80 2.89 12 3 ASP A 49 ? ? -83.75 39.85 13 3 PHE A 52 ? ? -39.98 -37.78 14 3 MET A 73 ? ? -99.37 37.49 15 3 PRO A 77 ? ? -69.78 86.08 16 4 SER A 2 ? ? 70.62 41.94 17 4 SER A 5 ? ? -161.78 105.83 18 4 ASP A 33 ? ? -61.20 -176.95 19 4 ALA A 38 ? ? -51.02 104.26 20 4 ASP A 49 ? ? -87.06 44.08 21 4 PRO A 77 ? ? -69.71 -176.34 22 5 SER A 5 ? ? -48.23 150.59 23 5 VAL A 11 ? ? -171.70 105.35 24 5 ASN A 13 ? ? -172.71 128.80 25 5 ALA A 38 ? ? -54.52 101.56 26 5 ASP A 49 ? ? -89.54 47.26 27 5 PHE A 52 ? ? -88.75 48.95 28 5 PRO A 77 ? ? -69.70 -179.44 29 6 HIS A 8 ? ? -49.12 172.30 30 6 VAL A 11 ? ? -38.89 151.24 31 6 LEU A 14 ? ? 75.04 38.28 32 6 PRO A 17 ? ? -69.68 -174.16 33 6 ALA A 38 ? ? -55.34 103.35 34 6 MET A 73 ? ? -102.69 45.57 35 6 SER A 75 ? ? -59.85 172.29 36 7 ASN A 15 ? ? -35.60 -39.70 37 7 PRO A 17 ? ? -69.81 -176.19 38 7 ALA A 38 ? ? -57.03 103.07 39 7 ASP A 49 ? ? -89.05 43.22 40 8 VAL A 11 ? ? -44.61 108.74 41 8 GLN A 16 ? ? -170.29 144.01 42 8 ALA A 22 ? ? -58.86 105.24 43 8 ASP A 33 ? ? -57.85 176.83 44 8 ALA A 38 ? ? -49.54 104.54 45 8 THR A 43 ? ? -67.30 97.64 46 8 ASP A 49 ? ? -83.09 44.70 47 8 MET A 73 ? ? -91.23 42.21 48 8 PRO A 77 ? ? -69.78 97.08 49 9 PRO A 31 ? ? -69.76 2.57 50 9 ALA A 38 ? ? -55.93 104.29 51 9 PHE A 52 ? ? -35.70 -39.98 52 10 VAL A 11 ? ? 36.22 34.12 53 10 PRO A 17 ? ? -69.77 -179.67 54 10 ALA A 22 ? ? -55.88 109.76 55 10 PRO A 31 ? ? -69.78 1.52 56 10 ALA A 38 ? ? -49.40 104.48 57 10 SER A 78 ? ? 38.04 42.46 58 11 ARG A 10 ? ? -105.62 43.92 59 11 ALA A 38 ? ? -59.57 104.09 60 11 MET A 73 ? ? -102.08 45.11 61 11 SER A 78 ? ? -34.50 111.96 62 12 ARG A 10 ? ? -38.70 108.35 63 12 ASP A 33 ? ? -61.85 -175.54 64 12 ALA A 38 ? ? -52.71 104.36 65 12 ASP A 49 ? ? -78.65 47.84 66 12 ASN A 74 ? ? -34.48 139.60 67 13 PRO A 17 ? ? -69.85 -172.84 68 13 PRO A 31 ? ? -69.78 2.37 69 13 SER A 50 ? ? -173.66 133.54 70 13 ASN A 74 ? ? -59.91 106.66 71 13 SER A 79 ? ? -134.12 -50.29 72 14 HIS A 8 ? ? -40.49 99.01 73 14 ARG A 10 ? ? -35.03 122.61 74 14 VAL A 11 ? ? -39.08 137.41 75 14 LEU A 14 ? ? -119.08 79.70 76 14 ASP A 33 ? ? -59.82 -179.04 77 14 ALA A 38 ? ? -47.30 104.03 78 14 MET A 73 ? ? -106.68 50.24 79 15 SER A 5 ? ? -133.55 -40.30 80 15 SER A 6 ? ? 36.68 42.42 81 15 VAL A 11 ? ? -107.75 45.01 82 15 ASN A 15 ? ? -39.54 -25.67 83 15 PRO A 31 ? ? -69.74 2.57 84 15 ALA A 38 ? ? -47.59 104.12 85 15 THR A 43 ? ? -68.87 96.27 86 15 ASP A 49 ? ? -83.57 42.87 87 15 MET A 73 ? ? -103.54 78.46 88 15 PRO A 77 ? ? -69.78 2.78 89 15 SER A 78 ? ? -34.76 124.58 90 16 ASN A 13 ? ? -83.59 46.85 91 16 ASN A 15 ? ? -34.84 -37.73 92 16 PRO A 17 ? ? -69.77 -177.01 93 16 PRO A 31 ? ? -69.80 3.05 94 16 ALA A 38 ? ? -47.79 103.69 95 16 PHE A 52 ? ? -38.73 -38.64 96 16 SER A 78 ? ? -39.06 134.28 97 17 VAL A 11 ? ? -85.08 39.43 98 17 PRO A 17 ? ? -69.77 -175.75 99 17 PRO A 31 ? ? -69.81 1.02 100 17 ALA A 38 ? ? -51.44 104.30 101 17 HIS A 51 ? ? -96.78 -62.21 102 17 PHE A 52 ? ? -35.10 -39.84 103 18 GLN A 16 ? ? -173.48 144.33 104 18 PRO A 31 ? ? -69.77 1.52 105 18 ALA A 38 ? ? -51.90 104.32 106 18 ASP A 49 ? ? -85.34 38.47 107 18 PRO A 77 ? ? -69.78 -173.79 108 19 SER A 3 ? ? 37.67 42.25 109 19 SER A 5 ? ? -167.50 118.45 110 19 PRO A 17 ? ? -69.80 -174.39 111 19 PRO A 31 ? ? -69.79 1.49 112 19 ALA A 38 ? ? -51.35 104.13 113 19 ASP A 49 ? ? -79.59 47.10 114 20 ARG A 10 ? ? -96.67 42.98 115 20 VAL A 11 ? ? -85.99 40.79 116 20 PRO A 31 ? ? -69.73 2.51 117 20 ALA A 38 ? ? -55.90 104.39 #