data_2D8X # _entry.id 2D8X # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2D8X pdb_00002d8x 10.2210/pdb2d8x/pdb RCSB RCSB025134 ? ? WWPDB D_1000025134 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hss001001107.2 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2D8X _pdbx_database_status.recvd_initial_deposition_date 2005-12-08 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Qin, X.R.' 1 'Hayashi, F.' 2 'Yokoyama, S.' 3 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 # _citation.id primary _citation.title ;Solution structure of the second LIM domain of particularly interesting new Cys-His protein (PINCH) ; _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Qin, X.R.' 1 ? primary 'Hayashi, F.' 2 ? primary 'Yokoyama, S.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein PINCH' 7559.577 1 ? ? 'LIM domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Particularly interesting new Cys-His protein, LIM and senescent cell antigen-like domains 1 ,PINCH protein ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKASGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKASGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hss001001107.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 CYS n 1 9 HIS n 1 10 GLN n 1 11 CYS n 1 12 GLY n 1 13 GLU n 1 14 PHE n 1 15 ILE n 1 16 ILE n 1 17 GLY n 1 18 ARG n 1 19 VAL n 1 20 ILE n 1 21 LYS n 1 22 ALA n 1 23 MET n 1 24 ASN n 1 25 ASN n 1 26 SER n 1 27 TRP n 1 28 HIS n 1 29 PRO n 1 30 GLU n 1 31 CYS n 1 32 PHE n 1 33 ARG n 1 34 CYS n 1 35 ASP n 1 36 LEU n 1 37 CYS n 1 38 GLN n 1 39 GLU n 1 40 VAL n 1 41 LEU n 1 42 ALA n 1 43 ASP n 1 44 ILE n 1 45 GLY n 1 46 PHE n 1 47 VAL n 1 48 LYS n 1 49 ASN n 1 50 ALA n 1 51 GLY n 1 52 ARG n 1 53 HIS n 1 54 LEU n 1 55 CYS n 1 56 ARG n 1 57 PRO n 1 58 CYS n 1 59 HIS n 1 60 ASN n 1 61 ARG n 1 62 GLU n 1 63 LYS n 1 64 ALA n 1 65 SER n 1 66 GLY n 1 67 PRO n 1 68 SER n 1 69 SER n 1 70 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene LIMS1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050302-42 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PINC_HUMAN _struct_ref.pdbx_db_accession P48059 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code CHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKA _struct_ref.pdbx_align_begin 70 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2D8X _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 64 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P48059 _struct_ref_seq.db_align_beg 70 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 126 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 64 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2D8X GLY A 1 ? UNP P48059 ? ? 'cloning artifact' 1 1 1 2D8X SER A 2 ? UNP P48059 ? ? 'cloning artifact' 2 2 1 2D8X SER A 3 ? UNP P48059 ? ? 'cloning artifact' 3 3 1 2D8X GLY A 4 ? UNP P48059 ? ? 'cloning artifact' 4 4 1 2D8X SER A 5 ? UNP P48059 ? ? 'cloning artifact' 5 5 1 2D8X SER A 6 ? UNP P48059 ? ? 'cloning artifact' 6 6 1 2D8X GLY A 7 ? UNP P48059 ? ? 'cloning artifact' 7 7 1 2D8X SER A 65 ? UNP P48059 ? ? 'cloning artifact' 65 8 1 2D8X GLY A 66 ? UNP P48059 ? ? 'cloning artifact' 66 9 1 2D8X PRO A 67 ? UNP P48059 ? ? 'cloning artifact' 67 10 1 2D8X SER A 68 ? UNP P48059 ? ? 'cloning artifact' 68 11 1 2D8X SER A 69 ? UNP P48059 ? ? 'cloning artifact' 69 12 1 2D8X GLY A 70 ? UNP P48059 ? ? 'cloning artifact' 70 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.29mM 13C,15N-labeled protein; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 0.05mM ZnCl2+1mM IDA; 90%H2O; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2D8X _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2D8X _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function,structures with the lowest energy,structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2D8X _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9296 'Kobayashi, N' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2D8X _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2D8X _struct.title 'Solution structure of the second LIM domain of particularly interesting new Cys-His protein (PINCH)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2D8X _struct_keywords.pdbx_keywords 'Structural protein, Cell cycle' _struct_keywords.text ;LIM domain; PINCH protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural protein, Cell cycle ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id CYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 55 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ALA _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 64 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id CYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 55 _struct_conf.end_auth_comp_id ALA _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 64 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 8 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 8 A ZN 201 1_555 ? ? ? ? ? ? ? 2.356 ? ? metalc2 metalc ? ? A CYS 11 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 11 A ZN 201 1_555 ? ? ? ? ? ? ? 2.351 ? ? metalc3 metalc ? ? A HIS 28 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 28 A ZN 201 1_555 ? ? ? ? ? ? ? 2.054 ? ? metalc4 metalc ? ? A CYS 31 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 31 A ZN 201 1_555 ? ? ? ? ? ? ? 2.261 ? ? metalc5 metalc ? ? A CYS 34 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 34 A ZN 401 1_555 ? ? ? ? ? ? ? 2.338 ? ? metalc6 metalc ? ? A CYS 37 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 37 A ZN 401 1_555 ? ? ? ? ? ? ? 2.351 ? ? metalc7 metalc ? ? A CYS 55 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 55 A ZN 401 1_555 ? ? ? ? ? ? ? 2.243 ? ? metalc8 metalc ? ? A CYS 58 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 58 A ZN 401 1_555 ? ? ? ? ? ? ? 2.053 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 20 ? ALA A 22 ? ILE A 20 ALA A 22 A 2 ASN A 25 ? TRP A 27 ? ASN A 25 TRP A 27 B 1 VAL A 47 ? ASN A 49 ? VAL A 47 ASN A 49 B 2 ARG A 52 ? LEU A 54 ? ARG A 52 LEU A 54 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ALA A 22 ? N ALA A 22 O ASN A 25 ? O ASN A 25 B 1 2 N VAL A 47 ? N VAL A 47 O LEU A 54 ? O LEU A 54 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 8 ? CYS A 8 . ? 1_555 ? 2 AC1 4 CYS A 11 ? CYS A 11 . ? 1_555 ? 3 AC1 4 HIS A 28 ? HIS A 28 . ? 1_555 ? 4 AC1 4 CYS A 31 ? CYS A 31 . ? 1_555 ? 5 AC2 4 CYS A 34 ? CYS A 34 . ? 1_555 ? 6 AC2 4 CYS A 37 ? CYS A 37 . ? 1_555 ? 7 AC2 4 CYS A 55 ? CYS A 55 . ? 1_555 ? 8 AC2 4 CYS A 58 ? CYS A 58 . ? 1_555 ? # _database_PDB_matrix.entry_id 2D8X _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2D8X _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 TRP 27 27 27 TRP TRP A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 HIS 53 53 53 HIS HIS A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 CYS 55 55 55 CYS CYS A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 CYS 58 58 58 CYS CYS A . n A 1 59 HIS 59 59 59 HIS HIS A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLY 70 70 70 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 8 ? A CYS 8 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 11 ? A CYS 11 ? 1_555 101.6 ? 2 SG ? A CYS 8 ? A CYS 8 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 28 ? A HIS 28 ? 1_555 104.7 ? 3 SG ? A CYS 11 ? A CYS 11 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 28 ? A HIS 28 ? 1_555 105.0 ? 4 SG ? A CYS 8 ? A CYS 8 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 31 ? A CYS 31 ? 1_555 113.1 ? 5 SG ? A CYS 11 ? A CYS 11 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 31 ? A CYS 31 ? 1_555 113.2 ? 6 ND1 ? A HIS 28 ? A HIS 28 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 31 ? A CYS 31 ? 1_555 117.7 ? 7 SG ? A CYS 34 ? A CYS 34 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 37 ? A CYS 37 ? 1_555 102.3 ? 8 SG ? A CYS 34 ? A CYS 34 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 55 ? A CYS 55 ? 1_555 114.5 ? 9 SG ? A CYS 37 ? A CYS 37 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 55 ? A CYS 55 ? 1_555 105.3 ? 10 SG ? A CYS 34 ? A CYS 34 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 58 ? A CYS 58 ? 1_555 114.8 ? 11 SG ? A CYS 37 ? A CYS 37 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 58 ? A CYS 58 ? 1_555 110.3 ? 12 SG ? A CYS 55 ? A CYS 55 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 58 ? A CYS 58 ? 1_555 108.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-06-08 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.value' 15 4 'Structure model' '_struct_conn.pdbx_dist_value' 16 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 17 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 18 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 21 4 'Structure model' '_struct_ref_seq_dif.details' 22 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 23 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 24 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 10 ? ? -48.85 -72.64 2 1 GLU A 13 ? ? -45.57 152.10 3 1 PHE A 32 ? ? -58.80 86.38 4 1 LEU A 41 ? ? -105.14 48.16 5 1 ALA A 64 ? ? -37.84 109.89 6 2 GLN A 10 ? ? -47.21 -70.80 7 2 GLU A 13 ? ? -45.52 152.87 8 2 MET A 23 ? ? 39.90 26.88 9 2 PHE A 32 ? ? -60.72 92.25 10 2 LEU A 41 ? ? -103.03 47.85 11 2 HIS A 59 ? ? -38.56 -29.25 12 2 PRO A 67 ? ? -69.76 1.49 13 3 GLN A 10 ? ? -46.73 -70.44 14 3 GLU A 13 ? ? -46.35 150.80 15 3 PHE A 32 ? ? -51.33 97.15 16 3 LEU A 36 ? ? -131.28 -36.16 17 3 ALA A 64 ? ? -33.58 120.08 18 3 PRO A 67 ? ? -69.78 -177.06 19 4 GLN A 10 ? ? -46.46 -73.29 20 4 GLU A 13 ? ? -45.68 153.01 21 4 MET A 23 ? ? 39.98 29.64 22 4 PHE A 32 ? ? -59.01 92.07 23 5 GLU A 13 ? ? -48.60 151.92 24 5 MET A 23 ? ? 38.78 32.46 25 5 PHE A 32 ? ? -47.68 90.10 26 5 LEU A 36 ? ? -132.22 -35.40 27 5 LEU A 41 ? ? -99.62 38.39 28 5 HIS A 59 ? ? -36.18 -34.46 29 5 ALA A 64 ? ? -33.95 126.91 30 6 SER A 2 ? ? -94.00 42.65 31 6 GLN A 10 ? ? -47.85 -72.13 32 6 GLU A 13 ? ? -49.28 152.43 33 6 MET A 23 ? ? 42.99 27.10 34 6 PHE A 32 ? ? -49.76 91.38 35 6 LEU A 36 ? ? -131.30 -34.33 36 6 LEU A 41 ? ? -103.51 45.27 37 6 ALA A 64 ? ? -38.81 119.43 38 6 PRO A 67 ? ? -69.77 -176.63 39 7 GLN A 10 ? ? -52.72 -71.03 40 7 GLU A 13 ? ? -44.01 159.31 41 7 MET A 23 ? ? 43.02 28.76 42 7 PHE A 32 ? ? -49.35 91.99 43 7 ASN A 49 ? ? -169.19 119.36 44 7 SER A 65 ? ? -48.31 108.01 45 7 SER A 69 ? ? -166.84 114.66 46 8 GLU A 13 ? ? -43.65 156.90 47 8 PHE A 32 ? ? -52.23 92.98 48 8 LEU A 41 ? ? -100.85 40.77 49 8 ALA A 64 ? ? -35.62 120.17 50 8 PRO A 67 ? ? -69.82 2.44 51 8 SER A 69 ? ? -48.50 150.30 52 9 GLU A 13 ? ? -47.51 150.81 53 9 PHE A 32 ? ? -53.36 82.95 54 9 VAL A 40 ? ? -39.64 110.49 55 9 ALA A 64 ? ? -38.18 123.02 56 9 PRO A 67 ? ? -69.83 2.62 57 10 GLN A 10 ? ? -47.19 -70.78 58 10 GLU A 13 ? ? -45.20 152.04 59 10 MET A 23 ? ? 38.98 32.12 60 10 PHE A 32 ? ? -52.49 83.34 61 10 VAL A 40 ? ? -37.99 111.61 62 10 ALA A 50 ? ? 44.11 28.85 63 10 SER A 69 ? ? -45.38 102.49 64 11 GLU A 13 ? ? -44.27 151.79 65 11 MET A 23 ? ? 41.82 28.81 66 11 PHE A 32 ? ? -52.41 93.82 67 11 LEU A 41 ? ? -101.70 41.48 68 11 ALA A 64 ? ? -45.91 105.35 69 11 PRO A 67 ? ? -69.75 -174.74 70 12 GLN A 10 ? ? -49.30 -70.63 71 12 GLU A 13 ? ? -42.56 158.21 72 12 MET A 23 ? ? 44.18 26.43 73 12 PHE A 32 ? ? -54.81 88.71 74 12 CYS A 34 ? ? -45.89 156.30 75 12 LEU A 36 ? ? -130.66 -36.82 76 12 ASN A 49 ? ? -167.25 114.24 77 12 HIS A 59 ? ? -39.80 -37.68 78 12 SER A 68 ? ? -58.48 109.30 79 13 GLU A 13 ? ? -45.94 150.86 80 13 PHE A 32 ? ? -58.31 92.88 81 14 GLN A 10 ? ? -47.92 -72.88 82 14 GLU A 13 ? ? -46.67 152.13 83 14 MET A 23 ? ? 39.07 32.08 84 14 PRO A 29 ? ? -69.78 0.42 85 14 PHE A 32 ? ? -60.01 93.16 86 14 LEU A 41 ? ? -103.35 43.43 87 14 ALA A 50 ? ? 42.80 27.34 88 14 HIS A 59 ? ? -38.41 -37.80 89 14 PRO A 67 ? ? -69.81 10.84 90 14 SER A 68 ? ? -31.02 130.12 91 15 SER A 6 ? ? -174.86 125.07 92 15 GLU A 13 ? ? -47.93 151.88 93 15 PHE A 32 ? ? -48.03 88.72 94 15 LEU A 36 ? ? -130.43 -34.63 95 15 LEU A 41 ? ? -102.88 41.93 96 15 ALA A 64 ? ? -35.56 100.25 97 15 SER A 65 ? ? -103.37 45.74 98 15 PRO A 67 ? ? -69.81 0.48 99 16 GLN A 10 ? ? -52.23 -73.46 100 16 MET A 23 ? ? 41.89 28.76 101 16 PHE A 32 ? ? -50.72 94.30 102 16 LEU A 36 ? ? -131.77 -35.71 103 16 ALA A 64 ? ? -35.96 128.27 104 16 PRO A 67 ? ? -69.74 0.34 105 17 SER A 3 ? ? -82.98 43.39 106 17 SER A 5 ? ? -120.25 -51.20 107 17 GLN A 10 ? ? -51.33 -72.17 108 17 GLU A 13 ? ? -44.58 160.65 109 17 PHE A 32 ? ? -51.15 97.92 110 17 LEU A 36 ? ? -131.03 -35.34 111 17 ASN A 49 ? ? -170.28 113.88 112 17 HIS A 59 ? ? -37.44 -34.28 113 18 SER A 6 ? ? -85.42 32.33 114 18 GLN A 10 ? ? -47.11 -71.90 115 18 GLU A 13 ? ? -43.79 160.07 116 18 MET A 23 ? ? 41.61 29.61 117 18 PHE A 32 ? ? -54.82 81.36 118 18 ALA A 64 ? ? -37.39 120.12 119 19 GLU A 13 ? ? -43.97 150.52 120 19 MET A 23 ? ? 49.33 29.30 121 19 PHE A 32 ? ? -54.77 81.96 122 19 VAL A 40 ? ? -39.02 110.56 123 19 LEU A 41 ? ? -99.65 39.40 124 19 PRO A 67 ? ? -69.77 2.92 125 20 GLN A 10 ? ? -48.62 -71.89 126 20 GLU A 13 ? ? -47.98 151.07 127 20 MET A 23 ? ? 40.02 27.13 128 20 PHE A 32 ? ? -60.31 92.37 129 20 ALA A 64 ? ? -82.79 43.28 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #