data_2D9E # _entry.id 2D9E # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2D9E pdb_00002d9e 10.2210/pdb2d9e/pdb RCSB RCSB025149 ? ? WWPDB D_1000025149 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk003000027.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2D9E _pdbx_database_status.recvd_initial_deposition_date 2005-12-09 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hatta, R.' 1 'Hayashi, F.' 2 'Izumi, K.' 3 'Yoshida, M.' 4 'Yokoyama, S.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title 'Solution structure of the Bromodomain of Peregrin' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hatta, R.' 1 ? primary 'Hayashi, F.' 2 ? primary 'Izumi, K.' 3 ? primary 'Yoshida, M.' 4 ? primary 'Yokoyama, S.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Peregrin _entity.formula_weight 13777.527 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment Bromodomain _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Bromodomain and PHD finger-containing protein 1, BR140 protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCL KYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMGSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCL KYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMGSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk003000027.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 PHE n 1 9 LEU n 1 10 ILE n 1 11 LEU n 1 12 LEU n 1 13 ARG n 1 14 LYS n 1 15 THR n 1 16 LEU n 1 17 GLU n 1 18 GLN n 1 19 LEU n 1 20 GLN n 1 21 GLU n 1 22 LYS n 1 23 ASP n 1 24 THR n 1 25 GLY n 1 26 ASN n 1 27 ILE n 1 28 PHE n 1 29 SER n 1 30 GLU n 1 31 PRO n 1 32 VAL n 1 33 PRO n 1 34 LEU n 1 35 SER n 1 36 GLU n 1 37 VAL n 1 38 PRO n 1 39 ASP n 1 40 TYR n 1 41 LEU n 1 42 ASP n 1 43 HIS n 1 44 ILE n 1 45 LYS n 1 46 LYS n 1 47 PRO n 1 48 MET n 1 49 ASP n 1 50 PHE n 1 51 PHE n 1 52 THR n 1 53 MET n 1 54 LYS n 1 55 GLN n 1 56 ASN n 1 57 LEU n 1 58 GLU n 1 59 ALA n 1 60 TYR n 1 61 ARG n 1 62 TYR n 1 63 LEU n 1 64 ASN n 1 65 PHE n 1 66 ASP n 1 67 ASP n 1 68 PHE n 1 69 GLU n 1 70 GLU n 1 71 ASP n 1 72 PHE n 1 73 ASN n 1 74 LEU n 1 75 ILE n 1 76 VAL n 1 77 SER n 1 78 ASN n 1 79 CYS n 1 80 LEU n 1 81 LYS n 1 82 TYR n 1 83 ASN n 1 84 ALA n 1 85 LYS n 1 86 ASP n 1 87 THR n 1 88 ILE n 1 89 PHE n 1 90 TYR n 1 91 ARG n 1 92 ALA n 1 93 ALA n 1 94 VAL n 1 95 ARG n 1 96 LEU n 1 97 ARG n 1 98 GLU n 1 99 GLN n 1 100 GLY n 1 101 GLY n 1 102 ALA n 1 103 VAL n 1 104 LEU n 1 105 ARG n 1 106 GLN n 1 107 ALA n 1 108 ARG n 1 109 ARG n 1 110 GLN n 1 111 ALA n 1 112 GLU n 1 113 LYS n 1 114 MET n 1 115 GLY n 1 116 SER n 1 117 GLY n 1 118 PRO n 1 119 SER n 1 120 SER n 1 121 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene BRPF1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050314-10 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name GB _struct_ref.db_code CAD28495 _struct_ref.pdbx_db_accession 19584408 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;FLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDT IFYRAAVRLREQGGAVLRQARRQAEKMG ; _struct_ref.pdbx_align_begin 633 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2D9E _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 115 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 19584408 _struct_ref_seq.db_align_beg 633 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 740 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 115 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2D9E GLY A 1 ? GB 19584408 ? ? 'cloning artifact' 1 1 1 2D9E SER A 2 ? GB 19584408 ? ? 'cloning artifact' 2 2 1 2D9E SER A 3 ? GB 19584408 ? ? 'cloning artifact' 3 3 1 2D9E GLY A 4 ? GB 19584408 ? ? 'cloning artifact' 4 4 1 2D9E SER A 5 ? GB 19584408 ? ? 'cloning artifact' 5 5 1 2D9E SER A 6 ? GB 19584408 ? ? 'cloning artifact' 6 6 1 2D9E GLY A 7 ? GB 19584408 ? ? 'cloning artifact' 7 7 1 2D9E SER A 116 ? GB 19584408 ? ? 'cloning artifact' 116 8 1 2D9E GLY A 117 ? GB 19584408 ? ? 'cloning artifact' 117 9 1 2D9E PRO A 118 ? GB 19584408 ? ? 'cloning artifact' 118 10 1 2D9E SER A 119 ? GB 19584408 ? ? 'cloning artifact' 119 11 1 2D9E SER A 120 ? GB 19584408 ? ? 'cloning artifact' 120 12 1 2D9E GLY A 121 ? GB 19584408 ? ? 'cloning artifact' 121 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 294.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1.26 mM 13C, 15N-labeled protein; 20mM d-Tris-HCl (pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O; 10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2D9E _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2D9E _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function,structures with the lowest energy,structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2D9E _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.932 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2D9E _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2D9E _struct.title 'Solution structure of the Bromodomain of Peregrin' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2D9E _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text ;FOUR-HELIX BUNDLE, transcription activator, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Transcription ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 6 ? ASP A 23 ? SER A 6 ASP A 23 1 ? 18 HELX_P HELX_P2 2 ASP A 39 ? ILE A 44 ? ASP A 39 ILE A 44 1 ? 6 HELX_P HELX_P3 3 ASP A 49 ? ALA A 59 ? ASP A 49 ALA A 59 1 ? 11 HELX_P HELX_P4 4 ASN A 64 ? ASN A 83 ? ASN A 64 ASN A 83 1 ? 20 HELX_P HELX_P5 5 THR A 87 ? MET A 114 ? THR A 87 MET A 114 1 ? 28 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2D9E _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2D9E _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 MET 53 53 53 MET MET A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 CYS 79 79 79 CYS CYS A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 GLN 106 106 106 GLN GLN A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 ARG 108 108 108 ARG ARG A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 GLN 110 110 110 GLN GLN A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 MET 114 114 114 MET MET A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 GLY 121 121 121 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-06-09 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 75 ? ? -36.23 -38.40 2 1 THR A 87 ? ? -57.70 174.71 3 1 PHE A 89 ? ? -38.90 -25.62 4 1 SER A 116 ? ? -62.14 88.19 5 2 SER A 3 ? ? -80.06 44.59 6 2 SER A 5 ? ? -86.49 35.45 7 2 PHE A 89 ? ? -38.84 -25.75 8 3 SER A 5 ? ? -55.16 89.72 9 3 ASP A 42 ? ? -38.13 -36.33 10 3 PRO A 47 ? ? -69.82 93.76 11 3 ILE A 75 ? ? -38.93 -27.93 12 3 PHE A 89 ? ? -39.03 -25.68 13 3 SER A 120 ? ? -126.31 -55.80 14 4 SER A 5 ? ? -100.31 53.58 15 4 ASP A 42 ? ? -37.08 -30.47 16 4 PHE A 89 ? ? -37.92 -26.65 17 4 SER A 116 ? ? -173.68 114.58 18 5 SER A 29 ? ? -49.32 -18.73 19 5 ASN A 78 ? ? -36.18 -31.16 20 5 THR A 87 ? ? -49.07 170.87 21 5 PHE A 89 ? ? -38.16 -26.33 22 5 MET A 114 ? ? -39.37 -38.74 23 6 PRO A 47 ? ? -69.79 97.80 24 6 SER A 77 ? ? -56.08 -70.83 25 6 ASN A 78 ? ? -37.33 -28.58 26 6 PHE A 89 ? ? -38.46 -26.11 27 6 PRO A 118 ? ? -69.65 95.45 28 7 SER A 77 ? ? -55.07 -70.30 29 7 LYS A 85 ? ? -39.85 -30.34 30 7 PHE A 89 ? ? -38.60 -26.03 31 8 ASP A 42 ? ? -34.41 -39.82 32 8 SER A 77 ? ? -62.31 -70.43 33 8 ASN A 78 ? ? -36.18 -32.98 34 8 LYS A 85 ? ? -37.48 -37.91 35 8 PHE A 89 ? ? -38.53 -26.21 36 8 SER A 116 ? ? -173.21 110.53 37 8 PRO A 118 ? ? -69.71 95.65 38 9 SER A 5 ? ? -82.87 43.23 39 9 ASP A 66 ? ? -38.67 -36.49 40 9 ASN A 78 ? ? -38.11 -35.69 41 9 ASP A 86 ? ? -102.99 45.84 42 9 PHE A 89 ? ? -38.29 -26.19 43 10 SER A 5 ? ? -99.90 43.91 44 10 ILE A 75 ? ? -36.12 -35.23 45 10 ASN A 78 ? ? -37.60 -32.91 46 10 LYS A 85 ? ? -35.87 -35.16 47 10 PHE A 89 ? ? -37.92 -26.63 48 10 ALA A 111 ? ? -49.81 -17.99 49 11 SER A 3 ? ? -126.52 -57.05 50 11 SER A 5 ? ? -66.32 82.30 51 11 ASP A 42 ? ? -39.80 -33.75 52 11 ASN A 78 ? ? -34.49 -36.23 53 11 PHE A 89 ? ? -38.29 -26.30 54 12 SER A 5 ? ? -90.86 46.28 55 12 ASN A 78 ? ? -35.86 -37.58 56 12 PHE A 89 ? ? -38.08 -26.36 57 13 THR A 87 ? ? -56.89 171.38 58 13 PHE A 89 ? ? -38.40 -26.14 59 13 PRO A 118 ? ? -69.70 1.71 60 14 SER A 77 ? ? -60.52 -70.18 61 14 ASN A 78 ? ? -38.21 -31.21 62 14 PHE A 89 ? ? -38.24 -26.45 63 14 MET A 114 ? ? -36.66 -33.55 64 14 PRO A 118 ? ? -69.87 99.24 65 15 ASP A 23 ? ? -69.91 83.14 66 15 ASP A 42 ? ? -38.63 -27.14 67 15 ILE A 75 ? ? -39.74 -31.58 68 15 PHE A 89 ? ? -38.37 -26.24 69 15 SER A 116 ? ? -101.78 79.72 70 16 SER A 5 ? ? -88.73 43.90 71 16 ASP A 42 ? ? -37.23 -34.83 72 16 ASP A 66 ? ? -34.86 -33.87 73 16 ILE A 75 ? ? -37.47 -30.48 74 16 ASN A 83 ? ? -68.28 -175.83 75 16 PHE A 89 ? ? -39.25 -25.57 76 17 LEU A 16 ? ? -37.37 -36.51 77 17 ASP A 42 ? ? -39.72 -33.14 78 17 PHE A 89 ? ? -38.06 -26.62 79 17 PRO A 118 ? ? -69.74 92.13 80 18 ASP A 42 ? ? -38.66 -38.84 81 18 SER A 77 ? ? -51.91 -70.41 82 18 THR A 87 ? ? -52.28 173.22 83 18 PHE A 89 ? ? -37.92 -26.53 84 18 ALA A 111 ? ? -39.99 -24.82 85 18 PRO A 118 ? ? -69.80 98.43 86 19 SER A 2 ? ? -61.82 82.44 87 19 PRO A 31 ? ? -69.72 -179.11 88 19 ASP A 42 ? ? -37.95 -32.06 89 19 ILE A 75 ? ? -33.43 -37.31 90 19 SER A 77 ? ? -66.94 -73.84 91 19 LYS A 85 ? ? -38.65 -39.78 92 19 PHE A 89 ? ? -38.75 -25.95 93 19 SER A 119 ? ? -39.78 159.46 94 20 ASP A 42 ? ? -37.88 -33.50 95 20 PRO A 47 ? ? -69.76 89.23 96 20 ILE A 75 ? ? -34.03 -39.38 97 20 THR A 87 ? ? -55.52 179.48 98 20 ILE A 88 ? ? -93.58 -62.80 99 20 PHE A 89 ? ? -37.38 -27.14 #