data_2D9H # _entry.id 2D9H # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2D9H pdb_00002d9h 10.2210/pdb2d9h/pdb RCSB RCSB025152 ? ? WWPDB D_1000025152 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002004816.2 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2D9H _pdbx_database_status.recvd_initial_deposition_date 2005-12-09 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhang, H.P.' 1 'Nagasima, T.' 2 'Hayashi, F.' 3 'Yokoyama, S.' 4 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 # _citation.id primary _citation.title 'Solution structure of the forth and fifth zf-C2H2 domains of zinc finger protein 692' _citation.journal_abbrev 'to be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, H.P.' 1 ? primary 'Nagashima, T.' 2 ? primary 'Hayashi, F.' 3 ? primary 'Yokoyama, S.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Zinc finger protein 692' 8371.428 1 ? ? 'zf-C2H2 domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQESSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQESSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002004816.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 LEU n 1 9 GLN n 1 10 CYS n 1 11 GLU n 1 12 ILE n 1 13 CYS n 1 14 GLY n 1 15 PHE n 1 16 THR n 1 17 CYS n 1 18 ARG n 1 19 GLN n 1 20 LYS n 1 21 ALA n 1 22 SER n 1 23 LEU n 1 24 ASN n 1 25 TRP n 1 26 HIS n 1 27 GLN n 1 28 ARG n 1 29 LYS n 1 30 HIS n 1 31 ALA n 1 32 GLU n 1 33 THR n 1 34 VAL n 1 35 ALA n 1 36 ALA n 1 37 LEU n 1 38 ARG n 1 39 PHE n 1 40 PRO n 1 41 CYS n 1 42 GLU n 1 43 PHE n 1 44 CYS n 1 45 GLY n 1 46 LYS n 1 47 ARG n 1 48 PHE n 1 49 GLU n 1 50 LYS n 1 51 PRO n 1 52 ASP n 1 53 SER n 1 54 VAL n 1 55 ALA n 1 56 ALA n 1 57 HIS n 1 58 ARG n 1 59 SER n 1 60 LYS n 1 61 SER n 1 62 HIS n 1 63 PRO n 1 64 ALA n 1 65 LEU n 1 66 LEU n 1 67 LEU n 1 68 ALA n 1 69 PRO n 1 70 GLN n 1 71 GLU n 1 72 SER n 1 73 SER n 1 74 GLY n 1 75 PRO n 1 76 SER n 1 77 SER n 1 78 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ZNF692 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050302-52 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name GB _struct_ref.db_code NP_060335 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code LQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQES _struct_ref.pdbx_align_begin 417 _struct_ref.pdbx_db_accession 21361766 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2D9H _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 72 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 21361766 _struct_ref_seq.db_align_beg 417 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 481 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 72 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2D9H GLY A 1 ? GB 21361766 ? ? 'cloning artifact' 1 1 1 2D9H SER A 2 ? GB 21361766 ? ? 'cloning artifact' 2 2 1 2D9H SER A 3 ? GB 21361766 ? ? 'cloning artifact' 3 3 1 2D9H GLY A 4 ? GB 21361766 ? ? 'cloning artifact' 4 4 1 2D9H SER A 5 ? GB 21361766 ? ? 'cloning artifact' 5 5 1 2D9H SER A 6 ? GB 21361766 ? ? 'cloning artifact' 6 6 1 2D9H GLY A 7 ? GB 21361766 ? ? 'cloning artifact' 7 7 1 2D9H SER A 73 ? GB 21361766 ? ? 'cloning artifact' 73 8 1 2D9H GLY A 74 ? GB 21361766 ? ? 'cloning artifact' 74 9 1 2D9H PRO A 75 ? GB 21361766 ? ? 'cloning artifact' 75 10 1 2D9H SER A 76 ? GB 21361766 ? ? 'cloning artifact' 76 11 1 2D9H SER A 77 ? GB 21361766 ? ? 'cloning artifact' 77 12 1 2D9H GLY A 78 ? GB 21361766 ? ? 'cloning artifact' 78 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.25mM 13C, 15N-labeled protein; 20mM d-Tris-HCl(pH7.0), 100mM NaCl, 1mM d-DTT, 0.02% NaN3, 50uM ZnCl2+1mM IDA' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2D9H _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2D9H _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2D9H _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.04 Johnson,B.A. 3 'data analysis' KUJIRA 0.93191 Kobayashi,N. 4 'structure solution' CYANA 2.0.17 Guntent,P. 5 refinement CYANA 2.0.17 Guntent,P. 6 # _exptl.entry_id 2D9H _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2D9H _struct.title 'Solution structure of the forth and fifth zf-C2H2 domains of zinc finger protein 692' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2D9H _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text ;zf-C2H2 domain, Zinc finger protein 692, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA binding protein ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 19 ? VAL A 34 ? GLN A 19 VAL A 34 1 ? 16 HELX_P HELX_P2 2 LYS A 50 ? SER A 61 ? LYS A 50 SER A 61 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 10 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 10 A ZN 201 1_555 ? ? ? ? ? ? ? 2.341 ? ? metalc2 metalc ? ? A CYS 13 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 13 A ZN 201 1_555 ? ? ? ? ? ? ? 2.291 ? ? metalc3 metalc ? ? A HIS 26 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 26 A ZN 201 1_555 ? ? ? ? ? ? ? 2.053 ? ? metalc4 metalc ? ? A HIS 30 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 30 A ZN 201 1_555 ? ? ? ? ? ? ? 2.013 ? ? metalc5 metalc ? ? A CYS 41 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 41 A ZN 401 1_555 ? ? ? ? ? ? ? 2.338 ? ? metalc6 metalc ? ? A CYS 44 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 44 A ZN 401 1_555 ? ? ? ? ? ? ? 2.310 ? ? metalc7 metalc ? ? A HIS 57 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 57 A ZN 401 1_555 ? ? ? ? ? ? ? 2.032 ? ? metalc8 metalc ? ? A HIS 62 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 62 A ZN 401 1_555 ? ? ? ? ? ? ? 2.043 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 8 ? GLN A 9 ? LEU A 8 GLN A 9 A 2 THR A 16 ? CYS A 17 ? THR A 16 CYS A 17 B 1 PHE A 39 ? PRO A 40 ? PHE A 39 PRO A 40 B 2 ARG A 47 ? PHE A 48 ? ARG A 47 PHE A 48 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 8 ? N LEU A 8 O CYS A 17 ? O CYS A 17 B 1 2 N PHE A 39 ? N PHE A 39 O PHE A 48 ? O PHE A 48 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 10 ? CYS A 10 . ? 1_555 ? 2 AC1 4 CYS A 13 ? CYS A 13 . ? 1_555 ? 3 AC1 4 HIS A 26 ? HIS A 26 . ? 1_555 ? 4 AC1 4 HIS A 30 ? HIS A 30 . ? 1_555 ? 5 AC2 4 CYS A 41 ? CYS A 41 . ? 1_555 ? 6 AC2 4 CYS A 44 ? CYS A 44 . ? 1_555 ? 7 AC2 4 HIS A 57 ? HIS A 57 . ? 1_555 ? 8 AC2 4 HIS A 62 ? HIS A 62 . ? 1_555 ? # _database_PDB_matrix.entry_id 2D9H _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2D9H _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 TRP 25 25 25 TRP TRP A . n A 1 26 HIS 26 26 26 HIS HIS A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 GLY 78 78 78 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 10 ? A CYS 10 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 13 ? A CYS 13 ? 1_555 112.6 ? 2 SG ? A CYS 10 ? A CYS 10 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 26 ? A HIS 26 ? 1_555 106.2 ? 3 SG ? A CYS 13 ? A CYS 13 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 26 ? A HIS 26 ? 1_555 110.0 ? 4 SG ? A CYS 10 ? A CYS 10 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 30 ? A HIS 30 ? 1_555 116.0 ? 5 SG ? A CYS 13 ? A CYS 13 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 30 ? A HIS 30 ? 1_555 109.5 ? 6 NE2 ? A HIS 26 ? A HIS 26 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 30 ? A HIS 30 ? 1_555 101.8 ? 7 SG ? A CYS 41 ? A CYS 41 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 44 ? A CYS 44 ? 1_555 103.7 ? 8 SG ? A CYS 41 ? A CYS 41 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 57 ? A HIS 57 ? 1_555 105.9 ? 9 SG ? A CYS 44 ? A CYS 44 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 57 ? A HIS 57 ? 1_555 112.6 ? 10 SG ? A CYS 41 ? A CYS 41 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 62 ? A HIS 62 ? 1_555 116.5 ? 11 SG ? A CYS 44 ? A CYS 44 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 62 ? A HIS 62 ? 1_555 105.9 ? 12 NE2 ? A HIS 57 ? A HIS 57 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 62 ? A HIS 62 ? 1_555 112.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-06-09 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 5 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 6 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 10 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 16 4 'Structure model' '_struct_ref_seq_dif.details' 17 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 18 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 19 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 34 ? ? -39.80 -35.95 2 1 LYS A 46 ? ? -51.96 -178.27 3 1 PRO A 69 ? ? -69.79 -175.74 4 1 GLN A 70 ? ? -56.22 175.29 5 2 LYS A 46 ? ? -52.05 -179.54 6 2 LEU A 67 ? ? -57.73 175.28 7 2 SER A 77 ? ? -91.65 -62.17 8 3 VAL A 34 ? ? -37.82 -34.07 9 3 GLU A 42 ? ? -68.46 1.37 10 3 LYS A 46 ? ? -52.07 -179.68 11 3 LEU A 67 ? ? -57.36 174.60 12 3 PRO A 69 ? ? -69.80 -174.29 13 4 VAL A 34 ? ? -34.13 -36.38 14 4 LYS A 46 ? ? -52.16 179.77 15 4 PRO A 69 ? ? -69.80 84.42 16 5 VAL A 34 ? ? -34.87 -37.02 17 5 LYS A 46 ? ? -53.57 -179.72 18 6 LYS A 46 ? ? -52.10 -179.25 19 6 LEU A 67 ? ? -56.16 177.79 20 6 PRO A 69 ? ? -69.77 9.76 21 7 LYS A 46 ? ? -51.99 -178.98 22 7 PRO A 69 ? ? -69.76 -168.46 23 8 VAL A 34 ? ? -32.17 -37.71 24 8 ALA A 36 ? ? -34.49 -39.37 25 8 LYS A 46 ? ? -52.71 -179.26 26 8 PRO A 69 ? ? -69.75 80.14 27 9 LYS A 46 ? ? -52.12 -179.43 28 10 VAL A 34 ? ? -38.08 -37.45 29 10 GLU A 42 ? ? -66.95 0.83 30 10 LYS A 46 ? ? -52.12 -177.90 31 10 PRO A 69 ? ? -69.79 -175.19 32 11 GLU A 42 ? ? -67.40 0.03 33 11 LYS A 46 ? ? -51.97 179.65 34 11 PRO A 69 ? ? -69.77 -179.76 35 12 VAL A 34 ? ? -32.82 -35.15 36 12 LYS A 46 ? ? -52.32 -179.08 37 12 LEU A 67 ? ? -57.14 170.28 38 12 PRO A 69 ? ? -69.79 -173.71 39 12 PRO A 75 ? ? -69.84 15.28 40 13 ALA A 21 ? ? -33.10 -38.92 41 13 VAL A 34 ? ? -36.42 -31.67 42 13 LYS A 46 ? ? -52.13 -178.80 43 13 LEU A 67 ? ? -57.14 173.63 44 13 PRO A 75 ? ? -69.77 87.53 45 14 ILE A 12 ? ? -56.19 -70.17 46 14 VAL A 34 ? ? -35.99 -29.76 47 14 GLU A 42 ? ? -69.78 1.80 48 14 LYS A 46 ? ? -52.30 -177.82 49 14 PRO A 75 ? ? -69.74 -174.45 50 15 LYS A 46 ? ? -52.04 -179.22 51 16 ILE A 12 ? ? -55.82 -70.42 52 16 LYS A 46 ? ? -52.03 -179.38 53 16 LEU A 67 ? ? -57.96 176.86 54 16 GLU A 71 ? ? -55.14 104.34 55 16 PRO A 75 ? ? -69.74 87.27 56 17 VAL A 34 ? ? -34.35 -32.04 57 17 GLU A 42 ? ? -68.06 0.02 58 17 LYS A 46 ? ? -52.09 -176.79 59 17 PRO A 75 ? ? -69.83 -165.61 60 18 GLU A 42 ? ? -68.80 0.61 61 18 LYS A 46 ? ? -51.98 179.96 62 18 PRO A 75 ? ? -69.76 88.64 63 19 VAL A 34 ? ? -37.43 -29.18 64 19 LYS A 46 ? ? -52.01 -178.71 65 19 LEU A 67 ? ? -57.47 178.06 66 20 ALA A 36 ? ? -38.13 -27.39 67 20 LYS A 46 ? ? -52.06 -179.29 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #