data_2D9T # _entry.id 2D9T # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2D9T pdb_00002d9t 10.2210/pdb2d9t/pdb RCSB RCSB025164 ? ? WWPDB D_1000025164 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id mmt008000619.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2D9T _pdbx_database_status.recvd_initial_deposition_date 2005-12-13 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Li, H.' 1 'Tomizawa, T.' 2 'Koshiba, S.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution structure of the Tudor domain of Tudor domain containing protein 3 from mouse' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Li, H.' 1 ? primary 'Tomizawa, T.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Yokoyama, S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Tudor domain-containing protein 3' _entity.formula_weight 8586.375 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Tudor domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGKVWKPGDECFALYWEDNKFYRAEVEALHSSGMTAVVKFTDYGNYEEVLLSNIKPVQTEAWVRDPNSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGKVWKPGDECFALYWEDNKFYRAEVEALHSSGMTAVVKFTDYGNYEEVLLSNIKPVQTEAWVRDPNSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier mmt008000619.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 LYS n 1 9 VAL n 1 10 TRP n 1 11 LYS n 1 12 PRO n 1 13 GLY n 1 14 ASP n 1 15 GLU n 1 16 CYS n 1 17 PHE n 1 18 ALA n 1 19 LEU n 1 20 TYR n 1 21 TRP n 1 22 GLU n 1 23 ASP n 1 24 ASN n 1 25 LYS n 1 26 PHE n 1 27 TYR n 1 28 ARG n 1 29 ALA n 1 30 GLU n 1 31 VAL n 1 32 GLU n 1 33 ALA n 1 34 LEU n 1 35 HIS n 1 36 SER n 1 37 SER n 1 38 GLY n 1 39 MET n 1 40 THR n 1 41 ALA n 1 42 VAL n 1 43 VAL n 1 44 LYS n 1 45 PHE n 1 46 THR n 1 47 ASP n 1 48 TYR n 1 49 GLY n 1 50 ASN n 1 51 TYR n 1 52 GLU n 1 53 GLU n 1 54 VAL n 1 55 LEU n 1 56 LEU n 1 57 SER n 1 58 ASN n 1 59 ILE n 1 60 LYS n 1 61 PRO n 1 62 VAL n 1 63 GLN n 1 64 THR n 1 65 GLU n 1 66 ALA n 1 67 TRP n 1 68 VAL n 1 69 ARG n 1 70 ASP n 1 71 PRO n 1 72 ASN n 1 73 SER n 1 74 GLY n 1 75 PRO n 1 76 SER n 1 77 SER n 1 78 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene Tdrd3 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050214-04 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TDRD3_MOUSE _struct_ref.pdbx_db_accession Q91W18 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KVWKPGDECFALYWEDNKFYRAEVEALHSSGMTAVVKFTDYGNYEEVLLSNIKPVQTEAW _struct_ref.pdbx_align_begin 553 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2D9T _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 67 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q91W18 _struct_ref_seq.db_align_beg 553 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 612 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 67 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2D9T GLY A 1 ? UNP Q91W18 ? ? 'cloning artifact' 1 1 1 2D9T SER A 2 ? UNP Q91W18 ? ? 'cloning artifact' 2 2 1 2D9T SER A 3 ? UNP Q91W18 ? ? 'cloning artifact' 3 3 1 2D9T GLY A 4 ? UNP Q91W18 ? ? 'cloning artifact' 4 4 1 2D9T SER A 5 ? UNP Q91W18 ? ? 'cloning artifact' 5 5 1 2D9T SER A 6 ? UNP Q91W18 ? ? 'cloning artifact' 6 6 1 2D9T GLY A 7 ? UNP Q91W18 ? ? 'cloning artifact' 7 7 1 2D9T VAL A 68 ? UNP Q91W18 ? ? 'cloning artifact' 68 8 1 2D9T ARG A 69 ? UNP Q91W18 ? ? 'cloning artifact' 69 9 1 2D9T ASP A 70 ? UNP Q91W18 ? ? 'cloning artifact' 70 10 1 2D9T PRO A 71 ? UNP Q91W18 ? ? 'cloning artifact' 71 11 1 2D9T ASN A 72 ? UNP Q91W18 ? ? 'cloning artifact' 72 12 1 2D9T SER A 73 ? UNP Q91W18 ? ? 'cloning artifact' 73 13 1 2D9T GLY A 74 ? UNP Q91W18 ? ? 'cloning artifact' 74 14 1 2D9T PRO A 75 ? UNP Q91W18 ? ? 'cloning artifact' 75 15 1 2D9T SER A 76 ? UNP Q91W18 ? ? 'cloning artifact' 76 16 1 2D9T SER A 77 ? UNP Q91W18 ? ? 'cloning artifact' 77 17 1 2D9T GLY A 78 ? UNP Q91W18 ? ? 'cloning artifact' 78 18 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.22mM Tudor domain U-15N, 13C; 20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2D9T _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2D9T _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2D9T _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.932 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2D9T _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2D9T _struct.title 'Solution structure of the Tudor domain of Tudor domain containing protein 3 from mouse' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2D9T _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;Tudor domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id LEU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 56 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 58 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id LEU _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 56 _struct_conf.end_auth_comp_id ASN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 58 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 51 ? LEU A 55 ? TYR A 51 LEU A 55 A 2 THR A 40 ? PHE A 45 ? THR A 40 PHE A 45 A 3 PHE A 26 ? LEU A 34 ? PHE A 26 LEU A 34 A 4 GLU A 15 ? LEU A 19 ? GLU A 15 LEU A 19 A 5 ILE A 59 ? PRO A 61 ? ILE A 59 PRO A 61 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 54 ? O VAL A 54 N ALA A 41 ? N ALA A 41 A 2 3 O VAL A 42 ? O VAL A 42 N ALA A 33 ? N ALA A 33 A 3 4 O TYR A 27 ? O TYR A 27 N ALA A 18 ? N ALA A 18 A 4 5 N PHE A 17 ? N PHE A 17 O LYS A 60 ? O LYS A 60 # _database_PDB_matrix.entry_id 2D9T _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2D9T _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 TRP 10 10 10 TRP TRP A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 TRP 21 21 21 TRP TRP A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 TRP 67 67 67 TRP TRP A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 GLY 78 78 78 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-06-13 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX Determination Method: Author determined ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 12 ? ? -69.77 99.78 2 1 ALA A 29 ? ? -170.73 -176.41 3 1 VAL A 31 ? ? -54.45 100.27 4 1 MET A 39 ? ? -132.20 -56.86 5 1 TYR A 48 ? ? -132.70 -39.92 6 1 ALA A 66 ? ? -91.31 41.75 7 1 ASP A 70 ? ? -173.08 141.15 8 2 SER A 2 ? ? -108.45 41.58 9 2 SER A 5 ? ? -91.10 40.09 10 2 ASP A 23 ? ? -131.79 -35.24 11 2 VAL A 31 ? ? -46.22 104.89 12 2 SER A 37 ? ? -71.20 -71.65 13 2 MET A 39 ? ? -133.75 -59.95 14 2 TYR A 48 ? ? -133.85 -41.39 15 2 GLU A 65 ? ? -91.50 39.35 16 2 ALA A 66 ? ? -92.75 43.79 17 2 SER A 73 ? ? -103.52 42.39 18 3 SER A 6 ? ? 36.00 41.49 19 3 PRO A 12 ? ? -69.83 95.17 20 3 TYR A 48 ? ? -134.15 -44.46 21 3 PRO A 71 ? ? -69.84 -172.19 22 3 PRO A 75 ? ? -69.77 89.02 23 4 VAL A 31 ? ? -46.73 106.18 24 4 SER A 37 ? ? -94.93 -65.29 25 4 MET A 39 ? ? -126.44 -58.93 26 4 ALA A 66 ? ? -86.02 42.78 27 4 TRP A 67 ? ? -50.83 91.96 28 4 SER A 76 ? ? -132.59 -48.75 29 5 VAL A 31 ? ? -57.51 100.90 30 5 ALA A 33 ? ? -172.20 132.97 31 5 GLN A 63 ? ? -35.20 147.50 32 5 ALA A 66 ? ? -92.78 42.94 33 5 TRP A 67 ? ? -38.19 132.98 34 5 ARG A 69 ? ? -45.37 101.35 35 5 PRO A 71 ? ? -69.78 -179.72 36 6 VAL A 31 ? ? -46.83 103.75 37 6 GLN A 63 ? ? -36.98 119.60 38 6 ALA A 66 ? ? -104.56 47.93 39 6 PRO A 71 ? ? -69.80 -173.67 40 7 SER A 2 ? ? -131.35 -43.33 41 7 SER A 5 ? ? -53.79 103.97 42 7 TYR A 48 ? ? -134.43 -41.26 43 7 GLN A 63 ? ? -34.67 141.27 44 7 THR A 64 ? ? -58.61 175.63 45 7 ALA A 66 ? ? 38.01 36.01 46 7 VAL A 68 ? ? -35.28 114.46 47 7 SER A 76 ? ? 71.40 40.01 48 8 SER A 37 ? ? -50.23 -71.74 49 8 GLU A 65 ? ? -68.06 82.21 50 8 ALA A 66 ? ? -116.84 51.20 51 8 VAL A 68 ? ? -35.76 111.66 52 8 PRO A 71 ? ? -69.75 97.66 53 9 PRO A 12 ? ? -69.70 85.34 54 9 ALA A 29 ? ? -171.78 -175.66 55 9 VAL A 31 ? ? -50.57 106.67 56 9 MET A 39 ? ? -122.63 -52.28 57 9 THR A 64 ? ? -112.26 70.90 58 9 ALA A 66 ? ? -35.55 -34.15 59 9 ARG A 69 ? ? 36.89 37.51 60 10 SER A 5 ? ? -35.28 117.05 61 10 VAL A 31 ? ? -55.77 108.12 62 10 TYR A 48 ? ? -130.96 -33.46 63 10 ALA A 66 ? ? -96.82 53.85 64 10 VAL A 68 ? ? -34.55 113.13 65 10 PRO A 71 ? ? -69.72 -176.27 66 10 PRO A 75 ? ? -69.74 90.33 67 11 SER A 2 ? ? -36.85 146.15 68 11 VAL A 31 ? ? -47.28 105.45 69 11 ALA A 33 ? ? -170.75 141.09 70 11 GLN A 63 ? ? -47.52 164.68 71 11 ALA A 66 ? ? -89.03 45.81 72 11 TRP A 67 ? ? -57.09 174.04 73 11 ASN A 72 ? ? -39.43 92.61 74 11 SER A 77 ? ? -99.86 -60.55 75 12 TYR A 20 ? ? -47.51 153.74 76 12 GLU A 32 ? ? -98.38 -61.14 77 12 MET A 39 ? ? -123.41 -53.94 78 12 GLU A 65 ? ? -68.56 77.02 79 12 PRO A 71 ? ? -69.71 1.98 80 12 ASN A 72 ? ? -34.49 139.12 81 13 LYS A 8 ? ? -165.65 112.59 82 13 PRO A 12 ? ? -69.76 98.30 83 13 VAL A 31 ? ? -58.71 102.23 84 13 THR A 64 ? ? -105.18 60.64 85 13 GLU A 65 ? ? -100.33 43.60 86 13 ALA A 66 ? ? -89.73 36.57 87 13 TRP A 67 ? ? -60.73 89.27 88 13 PRO A 71 ? ? -69.72 -175.13 89 13 SER A 76 ? ? 37.46 43.75 90 14 SER A 6 ? ? -128.01 -53.95 91 14 ASP A 23 ? ? -134.63 -34.84 92 14 MET A 39 ? ? -127.64 -55.82 93 14 GLU A 65 ? ? -91.83 50.28 94 14 PRO A 71 ? ? -69.77 -172.80 95 15 SER A 3 ? ? -66.94 98.89 96 15 ASP A 23 ? ? -132.17 -35.31 97 15 ASN A 24 ? ? 74.27 33.75 98 15 ASP A 70 ? ? -172.16 144.44 99 16 MET A 39 ? ? -133.11 -61.39 100 16 ALA A 66 ? ? -108.48 41.66 101 16 TRP A 67 ? ? -39.37 136.08 102 17 VAL A 31 ? ? -47.10 106.71 103 17 MET A 39 ? ? -123.62 -55.50 104 17 THR A 64 ? ? -171.32 127.11 105 17 GLU A 65 ? ? -102.91 79.74 106 17 ALA A 66 ? ? -111.23 53.37 107 17 VAL A 68 ? ? -108.63 53.08 108 17 PRO A 71 ? ? -69.76 98.07 109 18 ALA A 66 ? ? -92.94 47.11 110 18 TRP A 67 ? ? -39.47 107.56 111 18 PRO A 71 ? ? -69.73 -177.37 112 18 SER A 77 ? ? -170.03 132.78 113 19 ASP A 23 ? ? -130.21 -33.38 114 19 ALA A 29 ? ? -171.84 -176.79 115 19 ALA A 66 ? ? -82.75 42.37 116 20 VAL A 31 ? ? -47.01 106.10 117 20 MET A 39 ? ? -125.09 -60.56 118 20 ALA A 66 ? ? -103.13 43.60 119 20 TRP A 67 ? ? -54.86 176.82 120 20 ARG A 69 ? ? -37.25 123.14 121 20 PRO A 71 ? ? -69.81 -177.76 #