data_2DA4 # _entry.id 2DA4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DA4 pdb_00002da4 10.2210/pdb2da4/pdb RCSB RCSB025175 ? ? WWPDB D_1000025175 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hso003011245.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DA4 _pdbx_database_status.recvd_initial_deposition_date 2005-12-13 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ohnishi, S.' 1 'Kigawa, T.' 2 'Saito, K.' 3 'Koshiba, S.' 4 'Inoue, M.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution structure of the homeobox domain of the hypothetical protein, DKFZp686K21156' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ohnishi, S.' 1 ? primary 'Kigawa, T.' 2 ? primary 'Saito, K.' 3 ? primary 'Koshiba, S.' 4 ? primary 'Inoue, M.' 5 ? primary 'Yokoyama, S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Hypothetical protein DKFZp686K21156' _entity.formula_weight 8824.898 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'homeobox domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Hypothetical protein LOC139324' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGALQDRTQFSDRDLATLKKYWDNGMTSLGSVCREKIEAVATELNVDCEIVRTWIGNRRRKYRLMGIEVSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGALQDRTQFSDRDLATLKKYWDNGMTSLGSVCREKIEAVATELNVDCEIVRTWIGNRRRKYRLMGIEVSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hso003011245.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 ALA n 1 9 LEU n 1 10 GLN n 1 11 ASP n 1 12 ARG n 1 13 THR n 1 14 GLN n 1 15 PHE n 1 16 SER n 1 17 ASP n 1 18 ARG n 1 19 ASP n 1 20 LEU n 1 21 ALA n 1 22 THR n 1 23 LEU n 1 24 LYS n 1 25 LYS n 1 26 TYR n 1 27 TRP n 1 28 ASP n 1 29 ASN n 1 30 GLY n 1 31 MET n 1 32 THR n 1 33 SER n 1 34 LEU n 1 35 GLY n 1 36 SER n 1 37 VAL n 1 38 CYS n 1 39 ARG n 1 40 GLU n 1 41 LYS n 1 42 ILE n 1 43 GLU n 1 44 ALA n 1 45 VAL n 1 46 ALA n 1 47 THR n 1 48 GLU n 1 49 LEU n 1 50 ASN n 1 51 VAL n 1 52 ASP n 1 53 CYS n 1 54 GLU n 1 55 ILE n 1 56 VAL n 1 57 ARG n 1 58 THR n 1 59 TRP n 1 60 ILE n 1 61 GLY n 1 62 ASN n 1 63 ARG n 1 64 ARG n 1 65 ARG n 1 66 LYS n 1 67 TYR n 1 68 ARG n 1 69 LEU n 1 70 MET n 1 71 GLY n 1 72 ILE n 1 73 GLU n 1 74 VAL n 1 75 SER n 1 76 GLY n 1 77 PRO n 1 78 SER n 1 79 SER n 1 80 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene CXorf43 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050404-05 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name GB _struct_ref.db_code AAI01723 _struct_ref.pdbx_db_accession 75517232 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ALQDRTQFSDRDLATLKKYWDNGMTSLGSVCREKIEAVATELNVDCEIVRTWIGNRRRKYRLMGIEV _struct_ref.pdbx_align_begin 435 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DA4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 74 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 75517232 _struct_ref_seq.db_align_beg 435 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 501 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 74 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DA4 GLY A 1 ? GB 75517232 ? ? 'cloning artifact' 1 1 1 2DA4 SER A 2 ? GB 75517232 ? ? 'cloning artifact' 2 2 1 2DA4 SER A 3 ? GB 75517232 ? ? 'cloning artifact' 3 3 1 2DA4 GLY A 4 ? GB 75517232 ? ? 'cloning artifact' 4 4 1 2DA4 SER A 5 ? GB 75517232 ? ? 'cloning artifact' 5 5 1 2DA4 SER A 6 ? GB 75517232 ? ? 'cloning artifact' 6 6 1 2DA4 GLY A 7 ? GB 75517232 ? ? 'cloning artifact' 7 7 1 2DA4 SER A 75 ? GB 75517232 ? ? 'cloning artifact' 75 8 1 2DA4 GLY A 76 ? GB 75517232 ? ? 'cloning artifact' 76 9 1 2DA4 PRO A 77 ? GB 75517232 ? ? 'cloning artifact' 77 10 1 2DA4 SER A 78 ? GB 75517232 ? ? 'cloning artifact' 78 11 1 2DA4 SER A 79 ? GB 75517232 ? ? 'cloning artifact' 79 12 1 2DA4 GLY A 80 ? GB 75517232 ? ? 'cloning artifact' 80 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.0mM protein U-15N,13C; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2DA4 _pdbx_nmr_refine.method 'torsion angle dynamics, restrained molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2DA4 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DA4 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.932 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2DA4 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2DA4 _struct.title 'Solution structure of the homeobox domain of the hypothetical protein, DKFZp686K21156' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DA4 _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;homeobox domain, three helices with the DNA binding helix-turn-helix motif, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 16 ? ASP A 28 ? SER A 16 ASP A 28 1 ? 13 HELX_P HELX_P2 2 GLY A 35 ? ASN A 50 ? GLY A 35 ASN A 50 1 ? 16 HELX_P HELX_P3 3 ASP A 52 ? GLY A 71 ? ASP A 52 GLY A 71 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2DA4 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DA4 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 TRP 27 27 27 TRP TRP A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 MET 31 31 31 MET MET A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 TRP 59 59 59 TRP TRP A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 MET 70 70 70 MET MET A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 GLY 80 80 80 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-06-13 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 31 ? ? -76.69 48.24 2 1 GLU A 73 ? ? -88.14 44.89 3 1 VAL A 74 ? ? -83.32 44.75 4 2 MET A 31 ? ? -84.06 34.04 5 2 CYS A 53 ? ? -39.91 -33.53 6 2 TYR A 67 ? ? -93.79 -70.42 7 2 ARG A 68 ? ? -39.55 -38.29 8 2 SER A 75 ? ? -35.73 141.04 9 3 MET A 31 ? ? -84.63 32.57 10 3 THR A 32 ? ? -111.99 52.30 11 3 ALA A 44 ? ? -91.98 -63.27 12 3 GLU A 73 ? ? -89.10 39.89 13 4 SER A 5 ? ? -173.14 139.85 14 4 MET A 31 ? ? -76.31 48.47 15 4 CYS A 53 ? ? -39.90 -39.92 16 4 ARG A 57 ? ? -39.63 -35.49 17 4 ILE A 72 ? ? -48.87 104.91 18 4 GLU A 73 ? ? -78.99 45.53 19 5 ALA A 8 ? ? -64.76 94.56 20 5 THR A 13 ? ? -67.88 92.78 21 5 MET A 31 ? ? -78.89 46.74 22 5 SER A 75 ? ? -126.61 -56.19 23 5 PRO A 77 ? ? -69.78 1.77 24 6 ALA A 8 ? ? -41.09 161.44 25 6 MET A 31 ? ? -76.41 48.96 26 6 VAL A 74 ? ? -88.49 40.25 27 6 PRO A 77 ? ? -69.83 -179.22 28 7 ASP A 11 ? ? -109.30 44.70 29 7 ASP A 17 ? ? -38.72 -38.62 30 7 LYS A 66 ? ? -35.84 -30.74 31 8 GLN A 10 ? ? -174.67 133.35 32 8 MET A 31 ? ? -78.15 46.28 33 8 VAL A 37 ? ? -36.12 -38.20 34 8 CYS A 53 ? ? -38.10 -39.54 35 9 LEU A 9 ? ? -43.26 151.20 36 9 ASN A 29 ? ? -93.36 31.08 37 9 LEU A 34 ? ? -93.53 -74.12 38 9 ARG A 57 ? ? -37.33 -38.61 39 9 TYR A 67 ? ? -93.84 -61.22 40 9 GLU A 73 ? ? 34.14 45.31 41 10 SER A 6 ? ? -98.61 -61.30 42 10 ALA A 8 ? ? -51.44 173.31 43 10 ALA A 21 ? ? -38.88 -36.51 44 10 MET A 31 ? ? -79.67 44.23 45 10 THR A 32 ? ? -111.75 53.69 46 10 PRO A 77 ? ? -69.75 86.11 47 11 LEU A 9 ? ? -52.32 -75.25 48 11 GLN A 10 ? ? -175.42 128.27 49 11 MET A 31 ? ? -77.36 48.25 50 11 VAL A 37 ? ? -37.13 -34.93 51 11 ARG A 39 ? ? -37.46 -39.19 52 11 SER A 75 ? ? -37.41 108.66 53 12 SER A 3 ? ? -48.67 99.49 54 12 GLN A 10 ? ? -126.62 -61.28 55 12 VAL A 37 ? ? -34.09 -38.04 56 12 ARG A 39 ? ? -38.85 -39.47 57 12 SER A 75 ? ? -171.99 115.49 58 12 PRO A 77 ? ? -69.71 95.57 59 13 SER A 6 ? ? -36.47 146.37 60 13 ALA A 8 ? ? -83.04 45.61 61 13 MET A 31 ? ? -75.96 48.89 62 13 ALA A 44 ? ? -94.01 -61.07 63 13 VAL A 74 ? ? -102.29 41.11 64 13 PRO A 77 ? ? -69.79 88.19 65 14 ASP A 11 ? ? -49.15 166.95 66 14 ARG A 12 ? ? -43.03 107.96 67 14 MET A 31 ? ? -78.91 45.42 68 14 VAL A 37 ? ? -35.93 -38.47 69 14 CYS A 53 ? ? -39.93 -38.26 70 14 SER A 79 ? ? -171.32 148.79 71 15 ASP A 11 ? ? -125.79 -59.97 72 15 MET A 31 ? ? -75.68 48.76 73 15 VAL A 37 ? ? -38.57 -36.55 74 15 ILE A 55 ? ? -35.39 -37.70 75 16 SER A 5 ? ? -163.53 110.07 76 16 GLN A 10 ? ? -48.20 98.71 77 16 MET A 31 ? ? -80.72 42.34 78 16 LEU A 34 ? ? -109.71 -68.59 79 16 ARG A 57 ? ? -39.94 -35.17 80 16 PRO A 77 ? ? -69.74 89.69 81 17 SER A 6 ? ? -42.10 163.19 82 17 THR A 32 ? ? -81.74 39.86 83 18 LEU A 9 ? ? -58.42 -72.71 84 18 GLN A 10 ? ? -175.56 106.60 85 18 MET A 31 ? ? -83.01 37.68 86 18 LEU A 34 ? ? -105.46 -71.57 87 19 SER A 6 ? ? -43.79 156.11 88 19 MET A 31 ? ? -79.47 44.26 89 19 LEU A 34 ? ? -108.39 -68.53 90 19 SER A 36 ? ? -129.28 -50.62 91 19 TYR A 67 ? ? -48.46 -70.63 92 19 PRO A 77 ? ? -69.71 86.76 93 20 ASP A 11 ? ? -95.50 41.86 94 20 THR A 32 ? ? -81.82 39.82 95 20 LYS A 66 ? ? -36.70 -36.74 96 20 TYR A 67 ? ? -86.81 -70.08 97 20 ARG A 68 ? ? -38.77 -27.19 #