data_2DA6 # _entry.id 2DA6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DA6 pdb_00002da6 10.2210/pdb2da6/pdb RCSB RCSB025177 ? ? WWPDB D_1000025177 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DA6 _pdbx_database_status.recvd_initial_deposition_date 2005-12-13 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ohnishi, S.' 1 'Kigawa, T.' 2 'Sato, M.' 3 'Koshiba, S.' 4 'Inoue, M.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution structure of the homeobox domain of Hepatocyte nuclear factor 1-beta (HNF-1beta)' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ohnishi, S.' 1 ? primary 'Kigawa, T.' 2 ? primary 'Sato, M.' 3 ? primary 'Koshiba, S.' 4 ? primary 'Inoue, M.' 5 ? primary 'Yokoyama, S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Hepatocyte nuclear factor 1-beta' _entity.formula_weight 11416.564 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'homeobox domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'HNF-1beta, HNF-1B, Variant hepatic nuclear factor 1, VHNF1, Homeoprotein LFB3, Transcription factor 2, TCF-2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPSKAHGLGSNLVTEVRVYNWFANRRK EEAFRQKLAMDAYSSNSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPSKAHGLGSNLVTEVRVYNWFANRRK EEAFRQKLAMDAYSSNSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 ARG n 1 9 ASN n 1 10 ARG n 1 11 PHE n 1 12 LYS n 1 13 TRP n 1 14 GLY n 1 15 PRO n 1 16 ALA n 1 17 SER n 1 18 GLN n 1 19 GLN n 1 20 ILE n 1 21 LEU n 1 22 TYR n 1 23 GLN n 1 24 ALA n 1 25 TYR n 1 26 ASP n 1 27 ARG n 1 28 GLN n 1 29 LYS n 1 30 ASN n 1 31 PRO n 1 32 SER n 1 33 LYS n 1 34 GLU n 1 35 GLU n 1 36 ARG n 1 37 GLU n 1 38 ALA n 1 39 LEU n 1 40 VAL n 1 41 GLU n 1 42 GLU n 1 43 CYS n 1 44 ASN n 1 45 ARG n 1 46 ALA n 1 47 GLU n 1 48 CYS n 1 49 LEU n 1 50 GLN n 1 51 ARG n 1 52 GLY n 1 53 VAL n 1 54 SER n 1 55 PRO n 1 56 SER n 1 57 LYS n 1 58 ALA n 1 59 HIS n 1 60 GLY n 1 61 LEU n 1 62 GLY n 1 63 SER n 1 64 ASN n 1 65 LEU n 1 66 VAL n 1 67 THR n 1 68 GLU n 1 69 VAL n 1 70 ARG n 1 71 VAL n 1 72 TYR n 1 73 ASN n 1 74 TRP n 1 75 PHE n 1 76 ALA n 1 77 ASN n 1 78 ARG n 1 79 ARG n 1 80 LYS n 1 81 GLU n 1 82 GLU n 1 83 ALA n 1 84 PHE n 1 85 ARG n 1 86 GLN n 1 87 LYS n 1 88 LEU n 1 89 ALA n 1 90 MET n 1 91 ASP n 1 92 ALA n 1 93 TYR n 1 94 SER n 1 95 SER n 1 96 ASN n 1 97 SER n 1 98 GLY n 1 99 PRO n 1 100 SER n 1 101 SER n 1 102 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene HNF1B _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050404-17 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HNF1B_HUMAN _struct_ref.pdbx_db_accession P35680 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;RNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPSKAHGLGSNLVTEVRVYNWFANRRKEEAFRQK LAMDAYSSN ; _struct_ref.pdbx_align_begin 233 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DA6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 96 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P35680 _struct_ref_seq.db_align_beg 233 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 321 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 96 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DA6 GLY A 1 ? UNP P35680 ? ? 'cloning artifact' 1 1 1 2DA6 SER A 2 ? UNP P35680 ? ? 'cloning artifact' 2 2 1 2DA6 SER A 3 ? UNP P35680 ? ? 'cloning artifact' 3 3 1 2DA6 GLY A 4 ? UNP P35680 ? ? 'cloning artifact' 4 4 1 2DA6 SER A 5 ? UNP P35680 ? ? 'cloning artifact' 5 5 1 2DA6 SER A 6 ? UNP P35680 ? ? 'cloning artifact' 6 6 1 2DA6 GLY A 7 ? UNP P35680 ? ? 'cloning artifact' 7 7 1 2DA6 SER A 97 ? UNP P35680 ? ? 'cloning artifact' 97 8 1 2DA6 GLY A 98 ? UNP P35680 ? ? 'cloning artifact' 98 9 1 2DA6 PRO A 99 ? UNP P35680 ? ? 'cloning artifact' 99 10 1 2DA6 SER A 100 ? UNP P35680 ? ? 'cloning artifact' 100 11 1 2DA6 SER A 101 ? UNP P35680 ? ? 'cloning artifact' 101 12 1 2DA6 GLY A 102 ? UNP P35680 ? ? 'cloning artifact' 102 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.2mM protein U-15N,13C; 20mM d-Tris-HCl (pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2DA6 _pdbx_nmr_refine.method 'torsion angle dynamics, restrained molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2DA6 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DA6 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.932 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2DA6 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2DA6 _struct.title 'Solution structure of the homeobox domain of Hepatocyte nuclear factor 1-beta (HNF-1beta)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DA6 _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text ;homeobox domain, three helices with the DNA binding helix-turn-helix motif, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA binding protein ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 14 ? ASP A 26 ? GLY A 14 ASP A 26 1 ? 13 HELX_P HELX_P2 2 SER A 32 ? ARG A 51 ? SER A 32 ARG A 51 1 ? 20 HELX_P HELX_P3 3 LYS A 57 ? LEU A 65 ? LYS A 57 LEU A 65 5 ? 9 HELX_P HELX_P4 4 THR A 67 ? ASP A 91 ? THR A 67 ASP A 91 1 ? 25 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2DA6 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DA6 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 TRP 13 13 13 TRP TRP A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 HIS 59 59 59 HIS HIS A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 TRP 74 74 74 TRP TRP A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 MET 90 90 90 MET MET A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 PRO 99 99 99 PRO PRO A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 GLY 102 102 102 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-12-26 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 38 ? ? -47.30 -19.91 2 1 VAL A 53 ? ? -56.61 172.17 3 1 LEU A 61 ? ? -34.47 -36.34 4 1 SER A 95 ? ? -86.27 44.74 5 1 ASN A 96 ? ? -174.72 148.61 6 1 SER A 101 ? ? -174.02 144.69 7 2 PHE A 11 ? ? -172.24 107.09 8 2 VAL A 53 ? ? -60.00 173.97 9 2 LEU A 61 ? ? -39.73 -35.63 10 2 ASP A 91 ? ? -55.62 176.79 11 2 PRO A 99 ? ? -69.75 2.40 12 3 SER A 5 ? ? -163.04 109.62 13 3 SER A 6 ? ? -37.91 134.06 14 3 LEU A 61 ? ? -39.11 -34.58 15 3 SER A 95 ? ? -108.60 43.85 16 3 SER A 101 ? ? 35.97 46.61 17 4 LEU A 61 ? ? -37.36 -35.40 18 5 ARG A 10 ? ? -105.24 49.03 19 5 VAL A 53 ? ? -59.44 174.59 20 5 HIS A 59 ? ? -49.03 -19.17 21 5 LEU A 61 ? ? -35.84 -39.78 22 5 GLU A 68 ? ? -34.22 -37.92 23 5 SER A 97 ? ? -38.87 155.62 24 6 SER A 3 ? ? -49.29 160.12 25 6 VAL A 53 ? ? -58.81 174.51 26 6 PRO A 55 ? ? -69.74 2.61 27 6 LEU A 61 ? ? -39.66 -33.66 28 6 ASP A 91 ? ? -59.25 175.75 29 6 SER A 101 ? ? -165.09 112.13 30 7 SER A 3 ? ? -130.44 -51.58 31 7 SER A 6 ? ? -35.05 135.54 32 7 VAL A 53 ? ? -58.76 174.10 33 7 ASP A 91 ? ? -54.55 -178.91 34 7 SER A 95 ? ? -50.31 174.00 35 7 ASN A 96 ? ? -35.19 132.62 36 7 SER A 100 ? ? -175.01 123.67 37 8 ASN A 9 ? ? -55.17 109.30 38 8 PHE A 11 ? ? -36.80 126.88 39 8 VAL A 53 ? ? -59.94 174.13 40 9 VAL A 53 ? ? -59.73 173.76 41 9 LEU A 61 ? ? -34.60 -35.05 42 9 SER A 95 ? ? -34.66 133.84 43 10 SER A 2 ? ? -40.81 153.02 44 10 LYS A 33 ? ? -36.50 -37.64 45 10 LEU A 61 ? ? -36.27 -30.49 46 10 GLU A 68 ? ? -36.41 -39.46 47 10 PRO A 99 ? ? -69.74 85.15 48 10 SER A 100 ? ? -68.64 88.22 49 11 ASN A 9 ? ? 35.86 37.45 50 11 PHE A 11 ? ? -173.01 127.95 51 11 GLU A 68 ? ? -35.24 -38.47 52 11 TYR A 93 ? ? -36.41 123.04 53 11 SER A 95 ? ? -35.06 150.32 54 11 SER A 97 ? ? -42.82 164.16 55 11 PRO A 99 ? ? -69.73 -177.31 56 12 ARG A 8 ? ? -37.32 120.36 57 12 LYS A 33 ? ? -36.32 -39.08 58 12 VAL A 53 ? ? -59.79 174.46 59 12 LEU A 61 ? ? -35.97 -36.89 60 12 SER A 95 ? ? -67.09 94.50 61 13 SER A 2 ? ? -166.27 110.42 62 13 LYS A 57 ? ? -108.21 57.06 63 13 ARG A 85 ? ? -38.55 -29.14 64 13 ASP A 91 ? ? -54.74 -178.91 65 13 ALA A 92 ? ? -47.71 169.66 66 13 SER A 101 ? ? -58.35 170.29 67 14 ASN A 9 ? ? -95.85 40.27 68 14 LEU A 61 ? ? -36.53 -33.16 69 14 GLU A 68 ? ? -34.31 -39.84 70 14 ASP A 91 ? ? -48.85 174.90 71 14 SER A 94 ? ? -55.28 108.94 72 15 LYS A 33 ? ? -38.80 -36.14 73 15 ASP A 91 ? ? -38.21 147.31 74 16 SER A 3 ? ? -109.40 42.09 75 16 PHE A 11 ? ? -174.01 109.35 76 16 TRP A 13 ? ? -58.40 174.61 77 16 VAL A 53 ? ? -59.51 174.22 78 16 LEU A 61 ? ? -34.46 -37.35 79 16 ASP A 91 ? ? -54.44 172.26 80 16 ALA A 92 ? ? -35.37 143.71 81 16 SER A 94 ? ? 72.81 39.44 82 17 SER A 2 ? ? -40.12 155.99 83 17 ASN A 9 ? ? -123.24 -64.37 84 17 VAL A 53 ? ? -57.60 172.22 85 17 LEU A 61 ? ? -38.20 -35.09 86 17 GLU A 68 ? ? -33.88 -38.47 87 17 ASN A 96 ? ? 70.29 41.31 88 17 PRO A 99 ? ? -69.79 86.46 89 17 SER A 100 ? ? -48.65 106.27 90 18 LEU A 61 ? ? -34.47 -33.16 91 18 ASP A 91 ? ? -53.02 178.15 92 18 PRO A 99 ? ? -69.70 86.68 93 19 ARG A 10 ? ? -37.70 118.75 94 19 VAL A 53 ? ? -57.91 174.71 95 19 LEU A 61 ? ? -36.12 -39.95 96 19 GLU A 68 ? ? -33.65 -34.44 97 19 ASP A 91 ? ? -55.61 -179.17 98 19 PRO A 99 ? ? -69.76 0.27 99 19 SER A 100 ? ? -35.41 137.40 100 20 ARG A 8 ? ? -124.26 -64.54 101 20 ALA A 38 ? ? -47.84 -19.46 102 20 VAL A 53 ? ? -58.32 173.93 103 20 GLU A 68 ? ? -34.08 -33.47 104 20 SER A 100 ? ? -121.63 -61.03 105 20 SER A 101 ? ? -39.87 128.15 #