data_2DAD # _entry.id 2DAD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DAD pdb_00002dad 10.2210/pdb2dad/pdb RCSB RCSB025180 ? ? WWPDB D_1000025180 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk003000270.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DAD _pdbx_database_status.recvd_initial_deposition_date 2005-12-13 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ohnishi, S.' 1 'Kigawa, T.' 2 'Saito, K.' 3 'Koshiba, S.' 4 'Inoue, M.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution structure of the fifth crystall domain of the non-lens protein, Absent in melanoma 1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ohnishi, S.' 1 ? primary 'Kigawa, T.' 2 ? primary 'Saito, K.' 3 ? primary 'Koshiba, S.' 4 ? primary 'Inoue, M.' 5 ? primary 'Yokoyama, S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Absent in melanoma 1 protein' _entity.formula_weight 9899.649 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'The fifth crystall domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGQIHLFSEPQFQGHSQSFEETTSQIDDSFSTKSCRVSGGSWVVYDGENFTGNQYVLEEGHYPCLSAMGCPPGAT FKSLRFISGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGQIHLFSEPQFQGHSQSFEETTSQIDDSFSTKSCRVSGGSWVVYDGENFTGNQYVLEEGHYPCLSAMGCPPGAT FKSLRFISGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk003000270.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLN n 1 9 ILE n 1 10 HIS n 1 11 LEU n 1 12 PHE n 1 13 SER n 1 14 GLU n 1 15 PRO n 1 16 GLN n 1 17 PHE n 1 18 GLN n 1 19 GLY n 1 20 HIS n 1 21 SER n 1 22 GLN n 1 23 SER n 1 24 PHE n 1 25 GLU n 1 26 GLU n 1 27 THR n 1 28 THR n 1 29 SER n 1 30 GLN n 1 31 ILE n 1 32 ASP n 1 33 ASP n 1 34 SER n 1 35 PHE n 1 36 SER n 1 37 THR n 1 38 LYS n 1 39 SER n 1 40 CYS n 1 41 ARG n 1 42 VAL n 1 43 SER n 1 44 GLY n 1 45 GLY n 1 46 SER n 1 47 TRP n 1 48 VAL n 1 49 VAL n 1 50 TYR n 1 51 ASP n 1 52 GLY n 1 53 GLU n 1 54 ASN n 1 55 PHE n 1 56 THR n 1 57 GLY n 1 58 ASN n 1 59 GLN n 1 60 TYR n 1 61 VAL n 1 62 LEU n 1 63 GLU n 1 64 GLU n 1 65 GLY n 1 66 HIS n 1 67 TYR n 1 68 PRO n 1 69 CYS n 1 70 LEU n 1 71 SER n 1 72 ALA n 1 73 MET n 1 74 GLY n 1 75 CYS n 1 76 PRO n 1 77 PRO n 1 78 GLY n 1 79 ALA n 1 80 THR n 1 81 PHE n 1 82 LYS n 1 83 SER n 1 84 LEU n 1 85 ARG n 1 86 PHE n 1 87 ILE n 1 88 SER n 1 89 GLY n 1 90 PRO n 1 91 SER n 1 92 SER n 1 93 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene AIM1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050404-03 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AIM1_HUMAN _struct_ref.pdbx_db_accession Q9Y4K1 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QIHLFSEPQFQGHSQSFEETTSQIDDSFSTKSCRVSGGSWVVYDGENFTGNQYVLEEGHYPCLSAMGCPPGATFKSLRFI ; _struct_ref.pdbx_align_begin 1416 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DAD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 87 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9Y4K1 _struct_ref_seq.db_align_beg 1416 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1495 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 87 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DAD GLY A 1 ? UNP Q9Y4K1 ? ? 'cloning artifact' 1 1 1 2DAD SER A 2 ? UNP Q9Y4K1 ? ? 'cloning artifact' 2 2 1 2DAD SER A 3 ? UNP Q9Y4K1 ? ? 'cloning artifact' 3 3 1 2DAD GLY A 4 ? UNP Q9Y4K1 ? ? 'cloning artifact' 4 4 1 2DAD SER A 5 ? UNP Q9Y4K1 ? ? 'cloning artifact' 5 5 1 2DAD SER A 6 ? UNP Q9Y4K1 ? ? 'cloning artifact' 6 6 1 2DAD GLY A 7 ? UNP Q9Y4K1 ? ? 'cloning artifact' 7 7 1 2DAD SER A 88 ? UNP Q9Y4K1 ? ? 'cloning artifact' 88 8 1 2DAD GLY A 89 ? UNP Q9Y4K1 ? ? 'cloning artifact' 89 9 1 2DAD PRO A 90 ? UNP Q9Y4K1 ? ? 'cloning artifact' 90 10 1 2DAD SER A 91 ? UNP Q9Y4K1 ? ? 'cloning artifact' 91 11 1 2DAD SER A 92 ? UNP Q9Y4K1 ? ? 'cloning artifact' 92 12 1 2DAD GLY A 93 ? UNP Q9Y4K1 ? ? 'cloning artifact' 93 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1.1mM protein U-15N,13C; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2DAD _pdbx_nmr_refine.method 'torsion angle dynamics, restrained molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2DAD _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DAD _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.932 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2DAD _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2DAD _struct.title 'Solution structure of the fifth crystall domain of the non-lens protein, Absent in melanoma 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DAD _struct_keywords.pdbx_keywords ONCOPROTEIN _struct_keywords.text ;crystall domain, greek key pattern, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ONCOPROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ILE A 31 ? PHE A 35 ? ILE A 31 PHE A 35 5 ? 5 HELX_P HELX_P2 2 CYS A 69 ? GLY A 74 ? CYS A 69 GLY A 74 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 18 ? PHE A 24 ? GLN A 18 PHE A 24 A 2 GLN A 8 ? GLU A 14 ? GLN A 8 GLU A 14 A 3 SER A 39 ? SER A 43 ? SER A 39 SER A 43 A 4 GLY A 65 ? TYR A 67 ? GLY A 65 TYR A 67 B 1 GLN A 59 ? TYR A 60 ? GLN A 59 TYR A 60 B 2 SER A 46 ? TYR A 50 ? SER A 46 TYR A 50 B 3 SER A 83 ? ILE A 87 ? SER A 83 ILE A 87 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLN A 22 ? O GLN A 22 N LEU A 11 ? N LEU A 11 A 2 3 N PHE A 12 ? N PHE A 12 O SER A 39 ? O SER A 39 A 3 4 N CYS A 40 ? N CYS A 40 O TYR A 67 ? O TYR A 67 B 1 2 O TYR A 60 ? O TYR A 60 N VAL A 49 ? N VAL A 49 B 2 3 N SER A 46 ? N SER A 46 O ILE A 87 ? O ILE A 87 # _database_PDB_matrix.entry_id 2DAD _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DAD _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 TRP 47 47 47 TRP TRP A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 HIS 66 66 66 HIS HIS A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 CYS 69 69 69 CYS CYS A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 MET 73 73 73 MET MET A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 CYS 75 75 75 CYS CYS A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 GLY 93 93 93 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-06-13 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 32 ? ? -52.03 102.04 2 1 PRO A 77 ? ? -69.69 89.49 3 2 ASP A 32 ? ? -52.02 102.29 4 2 PRO A 77 ? ? -69.79 84.81 5 2 SER A 88 ? ? -54.99 104.44 6 2 PRO A 90 ? ? -69.78 3.03 7 3 THR A 27 ? ? -59.10 102.64 8 3 ASP A 32 ? ? -52.00 102.67 9 3 PRO A 77 ? ? -69.73 86.51 10 3 PRO A 90 ? ? -69.76 3.49 11 4 ASP A 32 ? ? -51.96 102.26 12 4 PRO A 90 ? ? -69.74 11.60 13 5 ASP A 32 ? ? -52.05 101.98 14 5 PRO A 90 ? ? -69.72 89.50 15 6 ASP A 32 ? ? -52.00 102.97 16 6 PRO A 77 ? ? -69.73 81.62 17 6 SER A 88 ? ? -57.91 103.19 18 6 PRO A 90 ? ? -69.76 -179.69 19 7 ASP A 32 ? ? -52.07 102.58 20 7 PRO A 77 ? ? -69.73 91.87 21 7 SER A 88 ? ? -58.44 102.09 22 7 PRO A 90 ? ? -69.79 5.22 23 8 THR A 27 ? ? -59.93 106.60 24 8 ASP A 32 ? ? -51.29 102.04 25 8 PRO A 77 ? ? -69.76 93.63 26 8 PRO A 90 ? ? -69.74 88.86 27 9 ASP A 32 ? ? -52.02 102.98 28 9 PRO A 77 ? ? -69.81 90.07 29 10 ASP A 32 ? ? -52.02 103.51 30 10 PRO A 77 ? ? -69.75 91.88 31 11 ASP A 32 ? ? -52.01 103.70 32 11 PRO A 77 ? ? -69.69 94.56 33 11 SER A 88 ? ? -57.04 105.16 34 11 PRO A 90 ? ? -69.72 0.02 35 12 ASP A 32 ? ? -52.04 102.45 36 12 PRO A 77 ? ? -69.71 3.46 37 12 PRO A 90 ? ? -69.73 2.89 38 13 ASP A 32 ? ? -49.46 102.06 39 13 PRO A 77 ? ? -69.76 3.19 40 14 ASP A 32 ? ? -52.00 105.32 41 14 PRO A 77 ? ? -69.79 87.09 42 15 ASP A 32 ? ? -50.86 102.04 43 15 PRO A 77 ? ? -69.77 84.07 44 16 THR A 27 ? ? -57.65 103.98 45 16 ASP A 32 ? ? -51.96 102.95 46 16 PRO A 77 ? ? -69.81 18.11 47 17 ASP A 32 ? ? -52.03 103.33 48 17 PRO A 77 ? ? -69.81 90.63 49 17 ILE A 87 ? ? -93.95 -70.61 50 18 ASP A 32 ? ? -51.99 102.35 51 18 PRO A 77 ? ? -69.76 3.72 52 19 THR A 27 ? ? -52.22 107.04 53 19 ASP A 32 ? ? -50.60 102.17 54 19 PRO A 77 ? ? -69.78 87.61 55 19 SER A 88 ? ? -52.40 102.12 56 19 PRO A 90 ? ? -69.73 2.74 57 20 ASP A 32 ? ? -52.02 102.66 58 20 ASN A 58 ? ? -54.14 175.04 59 20 PRO A 77 ? ? -69.74 89.03 60 20 PRO A 90 ? ? -69.72 2.72 #