data_2DAK # _entry.id 2DAK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DAK pdb_00002dak 10.2210/pdb2dak/pdb RCSB RCSB025187 ? ? WWPDB D_1000025187 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-06-14 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DAK _pdbx_database_status.recvd_initial_deposition_date 2005-12-14 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002005673.2 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhao, C.' 1 'Kigawa, T.' 2 'Sato, M.' 3 'Koshiba, S.' 4 'Inoue, M.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution Structure of the Second UBA Domain in the Human Ubiquitin Specific Protease 5 (Isopeptidase 5)' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhao, C.' 1 ? primary 'Kigawa, T.' 2 ? primary 'Sato, M.' 3 ? primary 'Koshiba, S.' 4 ? primary 'Inoue, M.' 5 ? primary 'Yokoyama, S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Ubiquitin carboxyl-terminal hydrolase 5' _entity.formula_weight 6519.079 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.1.2.15 _entity.pdbx_mutation ? _entity.pdbx_fragment 'UBA domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Ubiquitin thiolesterase 5, Ubiquitin-specific processing protease 5, Deubiquitinating enzyme 5, Isopeptidase T' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGPPEDCVTTIVSMGFSRDQALKALRATNNSLERAVDWIFSHIDDLDAEAAMSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGPPEDCVTTIVSMGFSRDQALKALRATNNSLERAVDWIFSHIDDLDAEAAMSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002005673.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 PRO n 1 9 PRO n 1 10 GLU n 1 11 ASP n 1 12 CYS n 1 13 VAL n 1 14 THR n 1 15 THR n 1 16 ILE n 1 17 VAL n 1 18 SER n 1 19 MET n 1 20 GLY n 1 21 PHE n 1 22 SER n 1 23 ARG n 1 24 ASP n 1 25 GLN n 1 26 ALA n 1 27 LEU n 1 28 LYS n 1 29 ALA n 1 30 LEU n 1 31 ARG n 1 32 ALA n 1 33 THR n 1 34 ASN n 1 35 ASN n 1 36 SER n 1 37 LEU n 1 38 GLU n 1 39 ARG n 1 40 ALA n 1 41 VAL n 1 42 ASP n 1 43 TRP n 1 44 ILE n 1 45 PHE n 1 46 SER n 1 47 HIS n 1 48 ILE n 1 49 ASP n 1 50 ASP n 1 51 LEU n 1 52 ASP n 1 53 ALA n 1 54 GLU n 1 55 ALA n 1 56 ALA n 1 57 MET n 1 58 SER n 1 59 GLY n 1 60 PRO n 1 61 SER n 1 62 SER n 1 63 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene USP5 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cell free synthesis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050704-16 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 MET 19 19 19 MET MET A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 TRP 43 43 43 TRP TRP A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 HIS 47 47 47 HIS HIS A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 MET 57 57 57 MET MET A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 GLY 63 63 63 GLY GLY A . n # _exptl.entry_id 2DAK _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2DAK _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2DAK _struct.title 'Solution Structure of the Second UBA Domain in the Human Ubiquitin Specific Protease 5 (Isopeptidase 5)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DAK _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text ;isopeptidase T, Ubiquitin Specific Protease 5, USP 5, UBA domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, HYDROLASE ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code UBP5_HUMAN _struct_ref.pdbx_db_accession P45974 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 723 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DAK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 57 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P45974 _struct_ref_seq.db_align_beg 723 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 772 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 57 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DAK GLY A 1 ? UNP P45974 ? ? 'cloning artifact' 1 1 1 2DAK SER A 2 ? UNP P45974 ? ? 'cloning artifact' 2 2 1 2DAK SER A 3 ? UNP P45974 ? ? 'cloning artifact' 3 3 1 2DAK GLY A 4 ? UNP P45974 ? ? 'cloning artifact' 4 4 1 2DAK SER A 5 ? UNP P45974 ? ? 'cloning artifact' 5 5 1 2DAK SER A 6 ? UNP P45974 ? ? 'cloning artifact' 6 6 1 2DAK GLY A 7 ? UNP P45974 ? ? 'cloning artifact' 7 7 1 2DAK SER A 58 ? UNP P45974 ? ? 'cloning artifact' 58 8 1 2DAK GLY A 59 ? UNP P45974 ? ? 'cloning artifact' 59 9 1 2DAK PRO A 60 ? UNP P45974 ? ? 'cloning artifact' 60 10 1 2DAK SER A 61 ? UNP P45974 ? ? 'cloning artifact' 61 11 1 2DAK SER A 62 ? UNP P45974 ? ? 'cloning artifact' 62 12 1 2DAK GLY A 63 ? UNP P45974 ? ? 'cloning artifact' 63 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 9 ? GLY A 20 ? PRO A 9 GLY A 20 1 ? 12 HELX_P HELX_P2 2 SER A 22 ? THR A 33 ? SER A 22 THR A 33 1 ? 12 HELX_P HELX_P3 3 LEU A 37 ? ASP A 50 ? LEU A 37 ASP A 50 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A THR 14 ? ? H A SER 18 ? ? 1.54 2 1 O A GLN 25 ? ? H A ALA 29 ? ? 1.54 3 1 O A ARG 39 ? ? H A TRP 43 ? ? 1.56 4 2 O A THR 14 ? ? H A SER 18 ? ? 1.52 5 3 O A THR 14 ? ? H A SER 18 ? ? 1.51 6 3 O A GLN 25 ? ? H A ALA 29 ? ? 1.55 7 3 O A LEU 30 ? ? H A ASN 35 ? ? 1.58 8 4 O A THR 14 ? ? H A SER 18 ? ? 1.50 9 4 O A GLU 10 ? ? H A THR 14 ? ? 1.52 10 4 O A GLN 25 ? ? H A ALA 29 ? ? 1.55 11 4 O A LEU 30 ? ? H A ASN 35 ? ? 1.56 12 4 O A ARG 39 ? ? H A TRP 43 ? ? 1.57 13 4 O A LYS 28 ? ? H A ALA 32 ? ? 1.58 14 5 O A THR 14 ? ? H A SER 18 ? ? 1.51 15 5 O A GLN 25 ? ? H A ALA 29 ? ? 1.55 16 5 O A ARG 39 ? ? H A TRP 43 ? ? 1.56 17 6 O A THR 14 ? ? H A SER 18 ? ? 1.51 18 6 O A GLN 25 ? ? H A ALA 29 ? ? 1.56 19 6 O A ARG 39 ? ? H A TRP 43 ? ? 1.57 20 6 O A LYS 28 ? ? H A ALA 32 ? ? 1.58 21 7 O A THR 14 ? ? H A SER 18 ? ? 1.50 22 7 O A ASP 24 ? ? H A LYS 28 ? ? 1.52 23 7 O A ARG 39 ? ? H A TRP 43 ? ? 1.54 24 7 O A GLU 10 ? ? H A THR 14 ? ? 1.54 25 7 O A GLN 25 ? ? H A ALA 29 ? ? 1.58 26 7 O A LEU 30 ? ? H A ASN 35 ? ? 1.58 27 7 O A SER 36 ? ? H A ALA 40 ? ? 1.59 28 8 O A GLN 25 ? ? H A ALA 29 ? ? 1.54 29 8 O A ALA 29 ? ? H A THR 33 ? ? 1.58 30 9 O A THR 14 ? ? H A SER 18 ? ? 1.50 31 9 O A ALA 29 ? ? H A THR 33 ? ? 1.56 32 9 O A LYS 28 ? ? H A ALA 32 ? ? 1.57 33 9 O A ALA 40 ? ? H A ILE 44 ? ? 1.58 34 9 O A GLN 25 ? ? H A ALA 29 ? ? 1.59 35 10 O A GLN 25 ? ? H A ALA 29 ? ? 1.53 36 10 O A THR 14 ? ? H A SER 18 ? ? 1.57 37 10 O A ALA 29 ? ? H A THR 33 ? ? 1.57 38 11 O A THR 14 ? ? H A SER 18 ? ? 1.50 39 11 O A GLN 25 ? ? H A ALA 29 ? ? 1.51 40 11 O A ALA 29 ? ? H A THR 33 ? ? 1.57 41 12 O A THR 14 ? ? H A SER 18 ? ? 1.51 42 12 O A ARG 39 ? ? H A TRP 43 ? ? 1.53 43 12 O A LEU 30 ? ? H A THR 33 ? ? 1.56 44 12 O A ASP 24 ? ? H A LYS 28 ? ? 1.57 45 12 O A LEU 30 ? ? H A ASN 35 ? ? 1.58 46 12 O A GLN 25 ? ? H A ALA 29 ? ? 1.60 47 13 O A THR 14 ? ? H A SER 18 ? ? 1.54 48 13 O A GLU 10 ? ? H A THR 14 ? ? 1.55 49 13 O A ALA 40 ? ? H A ILE 44 ? ? 1.55 50 13 O A ALA 29 ? ? H A THR 33 ? ? 1.56 51 13 O A GLN 25 ? ? H A ALA 29 ? ? 1.58 52 14 O A THR 14 ? ? H A SER 18 ? ? 1.50 53 14 O A GLN 25 ? ? H A ALA 29 ? ? 1.55 54 14 O A ALA 29 ? ? H A THR 33 ? ? 1.57 55 15 O A GLU 10 ? ? H A THR 14 ? ? 1.51 56 15 O A GLN 25 ? ? H A ALA 29 ? ? 1.53 57 15 O A THR 14 ? ? H A SER 18 ? ? 1.53 58 15 O A ALA 29 ? ? H A THR 33 ? ? 1.56 59 15 O A SER 36 ? ? H A ALA 40 ? ? 1.59 60 15 O A LYS 28 ? ? H A ALA 32 ? ? 1.59 61 16 O A THR 14 ? ? H A SER 18 ? ? 1.50 62 16 O A GLN 25 ? ? H A ALA 29 ? ? 1.55 63 16 O A ALA 29 ? ? H A THR 33 ? ? 1.60 64 17 O A ASP 24 ? ? H A LYS 28 ? ? 1.50 65 17 O A THR 14 ? ? H A SER 18 ? ? 1.54 66 17 O A ARG 39 ? ? H A TRP 43 ? ? 1.55 67 17 O A LEU 30 ? ? H A ASN 35 ? ? 1.57 68 17 O A GLN 25 ? ? H A ALA 29 ? ? 1.58 69 18 O A THR 14 ? ? H A SER 18 ? ? 1.50 70 18 O A GLN 25 ? ? H A ALA 29 ? ? 1.54 71 18 O A LEU 30 ? ? H A ASN 35 ? ? 1.56 72 18 O A SER 36 ? ? H A ALA 40 ? ? 1.56 73 19 O A THR 14 ? ? H A SER 18 ? ? 1.50 74 19 O A LEU 30 ? ? H A ASN 35 ? ? 1.54 75 19 O A ARG 39 ? ? H A TRP 43 ? ? 1.55 76 19 O A GLN 25 ? ? H A ALA 29 ? ? 1.55 77 19 O A SER 36 ? ? H A ALA 40 ? ? 1.55 78 20 O A GLN 25 ? ? H A ALA 29 ? ? 1.53 79 20 O A THR 14 ? ? H A SER 18 ? ? 1.54 80 20 O A ASP 24 ? ? H A LYS 28 ? ? 1.57 81 20 O A ALA 29 ? ? H A THR 33 ? ? 1.58 82 20 O A ASP 11 ? ? H A THR 15 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 3 ? ? -178.16 88.46 2 1 SER A 6 ? ? -47.79 160.22 3 1 ASP A 50 ? ? 168.44 -38.01 4 1 LEU A 51 ? ? -67.73 78.76 5 1 GLU A 54 ? ? -41.63 157.48 6 1 SER A 61 ? ? -178.93 123.71 7 2 SER A 5 ? ? -179.94 -59.31 8 2 SER A 6 ? ? -152.00 83.02 9 2 ASN A 35 ? ? 48.97 70.56 10 2 ASP A 52 ? ? -140.11 -55.52 11 2 ALA A 53 ? ? 51.17 73.22 12 2 ALA A 56 ? ? -164.15 88.10 13 3 SER A 3 ? ? 62.97 111.90 14 3 SER A 6 ? ? 58.31 102.22 15 3 THR A 33 ? ? -102.30 45.35 16 3 ASN A 35 ? ? 65.17 69.87 17 3 ASP A 50 ? ? -116.44 77.18 18 3 ALA A 53 ? ? -177.63 80.38 19 3 GLU A 54 ? ? 73.64 -58.61 20 3 ALA A 55 ? ? 51.31 97.71 21 3 ALA A 56 ? ? -161.56 112.50 22 3 MET A 57 ? ? 58.44 87.30 23 4 SER A 5 ? ? -67.02 79.46 24 4 THR A 33 ? ? -88.99 40.16 25 4 ASN A 35 ? ? 65.61 82.63 26 4 ASP A 50 ? ? 179.89 106.96 27 4 GLU A 54 ? ? -165.18 113.45 28 4 SER A 61 ? ? -42.83 163.39 29 4 SER A 62 ? ? 48.03 92.12 30 5 ASN A 35 ? ? 61.49 66.66 31 5 ASP A 50 ? ? 60.40 103.33 32 5 ALA A 55 ? ? 51.25 97.37 33 5 ALA A 56 ? ? -64.91 91.86 34 5 SER A 61 ? ? 56.48 108.00 35 5 SER A 62 ? ? 178.36 147.67 36 6 SER A 5 ? ? -123.10 -58.51 37 6 THR A 33 ? ? -97.43 43.02 38 6 ILE A 44 ? ? -72.47 -70.98 39 6 ASP A 50 ? ? 65.63 107.28 40 6 ASP A 52 ? ? 49.45 94.00 41 6 ALA A 53 ? ? -161.77 63.26 42 6 GLU A 54 ? ? 58.07 80.13 43 6 SER A 58 ? ? 70.07 -62.80 44 6 SER A 62 ? ? 59.74 152.41 45 7 SER A 3 ? ? -148.01 -59.45 46 7 SER A 6 ? ? 59.73 152.56 47 7 ASN A 35 ? ? 61.69 79.92 48 7 ASP A 49 ? ? -169.89 96.86 49 7 ASP A 52 ? ? 60.18 109.00 50 7 SER A 61 ? ? -171.04 117.46 51 8 SER A 3 ? ? -160.41 -58.59 52 8 SER A 5 ? ? -122.68 -57.90 53 8 THR A 33 ? ? -89.03 40.19 54 8 ASN A 35 ? ? 58.38 71.51 55 8 ALA A 53 ? ? -131.98 -46.28 56 8 GLU A 54 ? ? -173.06 81.84 57 8 ALA A 55 ? ? -166.50 -59.19 58 9 SER A 3 ? ? -162.16 99.94 59 9 SER A 5 ? ? -156.76 76.88 60 9 SER A 6 ? ? -143.05 -60.96 61 9 ILE A 16 ? ? -54.31 -71.71 62 9 THR A 33 ? ? -89.02 40.16 63 9 ASN A 35 ? ? 40.46 80.02 64 9 ILE A 44 ? ? -54.46 -71.81 65 9 LEU A 51 ? ? -67.32 75.57 66 9 ASP A 52 ? ? 71.33 112.02 67 9 ALA A 53 ? ? -175.15 74.27 68 9 GLU A 54 ? ? -39.24 111.70 69 9 ALA A 55 ? ? -169.81 81.21 70 9 MET A 57 ? ? -157.79 88.09 71 10 SER A 3 ? ? 62.60 140.15 72 10 SER A 5 ? ? -150.57 -60.05 73 10 SER A 6 ? ? 60.70 161.87 74 10 THR A 33 ? ? -93.89 42.42 75 10 ASN A 35 ? ? 40.59 73.23 76 10 ILE A 44 ? ? -56.57 -70.13 77 10 ASP A 50 ? ? 60.94 103.71 78 10 ASP A 52 ? ? -161.79 102.04 79 10 ALA A 53 ? ? -158.85 74.64 80 10 ALA A 55 ? ? -160.76 99.05 81 10 ALA A 56 ? ? 46.75 78.46 82 10 MET A 57 ? ? -169.62 107.23 83 11 SER A 3 ? ? -39.95 141.29 84 11 SER A 5 ? ? 53.28 83.40 85 11 SER A 6 ? ? 60.53 86.18 86 11 GLU A 10 ? ? -90.40 -61.63 87 11 ILE A 16 ? ? -54.71 -71.71 88 11 ASN A 35 ? ? 40.45 76.68 89 11 ILE A 44 ? ? -63.93 -70.06 90 11 ASP A 52 ? ? 55.04 97.73 91 11 ALA A 53 ? ? -156.04 -45.87 92 11 GLU A 54 ? ? 65.47 155.25 93 11 ALA A 55 ? ? 62.51 77.40 94 12 SER A 5 ? ? -150.42 -61.47 95 12 SER A 6 ? ? 66.06 96.58 96 12 ASN A 34 ? ? 56.00 19.18 97 12 ASN A 35 ? ? 79.78 62.92 98 12 ILE A 44 ? ? -71.01 -72.33 99 12 ASP A 50 ? ? 173.17 113.19 100 12 ASP A 52 ? ? -124.53 -57.49 101 12 GLU A 54 ? ? -156.80 -59.87 102 12 ALA A 55 ? ? 64.19 153.22 103 12 ALA A 56 ? ? 42.47 79.15 104 12 SER A 61 ? ? -157.57 88.49 105 12 SER A 62 ? ? 57.64 83.93 106 13 SER A 2 ? ? 49.30 95.53 107 13 GLU A 10 ? ? -90.16 -62.90 108 13 THR A 33 ? ? -90.96 32.70 109 13 ASN A 35 ? ? 42.45 79.41 110 13 ILE A 44 ? ? -56.10 -70.10 111 13 ASP A 50 ? ? 67.07 110.23 112 13 LEU A 51 ? ? -104.17 -63.97 113 13 ALA A 53 ? ? -161.77 -44.45 114 13 ALA A 55 ? ? 48.30 83.66 115 13 MET A 57 ? ? 56.99 109.65 116 13 SER A 62 ? ? -175.02 126.54 117 14 SER A 2 ? ? 57.30 92.47 118 14 SER A 3 ? ? 57.89 96.07 119 14 ILE A 16 ? ? -57.18 -71.35 120 14 THR A 33 ? ? -93.79 42.42 121 14 ASP A 50 ? ? -138.70 -47.25 122 14 ASP A 52 ? ? 42.70 86.83 123 14 GLU A 54 ? ? 68.79 148.63 124 14 ALA A 55 ? ? -64.71 88.83 125 14 ALA A 56 ? ? -166.40 62.05 126 15 SER A 2 ? ? 62.64 159.18 127 15 SER A 3 ? ? -174.19 -58.50 128 15 ASN A 34 ? ? 44.12 73.12 129 15 ASN A 35 ? ? 40.47 83.44 130 15 ASP A 50 ? ? -160.62 99.94 131 15 ASP A 52 ? ? 55.15 101.52 132 15 ALA A 56 ? ? -173.88 102.24 133 15 SER A 62 ? ? -43.55 107.80 134 16 SER A 2 ? ? -162.06 110.22 135 16 SER A 6 ? ? -142.39 -59.63 136 16 CYS A 12 ? ? -50.24 -70.01 137 16 THR A 33 ? ? -97.36 44.31 138 16 ILE A 44 ? ? -64.80 -70.64 139 16 ASP A 49 ? ? -100.01 69.82 140 16 ASP A 50 ? ? -169.58 69.55 141 16 LEU A 51 ? ? 38.33 87.21 142 16 ASP A 52 ? ? -171.67 92.37 143 16 GLU A 54 ? ? -107.88 53.45 144 16 ALA A 56 ? ? -58.14 171.83 145 16 SER A 62 ? ? -170.65 82.49 146 17 SER A 2 ? ? 179.61 145.46 147 17 ASN A 34 ? ? 40.49 29.90 148 17 ASN A 35 ? ? 70.11 66.57 149 17 HIS A 47 ? ? -90.79 45.47 150 17 ASP A 49 ? ? 70.26 -61.02 151 17 ASP A 50 ? ? 178.37 100.88 152 17 ASP A 52 ? ? -152.02 -56.29 153 17 ALA A 55 ? ? -133.17 -62.00 154 17 ALA A 56 ? ? 58.94 78.67 155 17 SER A 62 ? ? 63.13 106.92 156 18 ILE A 16 ? ? -59.33 -72.41 157 18 THR A 33 ? ? -95.51 43.03 158 18 ASN A 35 ? ? 67.89 71.10 159 18 ILE A 44 ? ? -62.67 -71.26 160 18 LEU A 51 ? ? -102.29 69.30 161 18 ASP A 52 ? ? -179.06 128.36 162 18 GLU A 54 ? ? 48.75 97.30 163 18 ALA A 56 ? ? 63.18 106.31 164 19 SER A 3 ? ? 67.17 -72.34 165 19 SER A 6 ? ? 65.94 153.06 166 19 THR A 33 ? ? -89.81 39.39 167 19 ASN A 35 ? ? 67.72 70.55 168 19 HIS A 47 ? ? -91.58 43.76 169 19 ASP A 52 ? ? 44.66 91.27 170 20 SER A 3 ? ? -176.50 128.74 171 20 SER A 5 ? ? 64.38 88.61 172 20 SER A 6 ? ? -155.70 -58.63 173 20 THR A 33 ? ? -96.21 43.61 174 20 ASN A 35 ? ? 40.21 70.71 175 20 LEU A 51 ? ? 38.36 78.82 176 20 ASP A 52 ? ? 174.44 118.90 177 20 ALA A 55 ? ? 61.66 168.82 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 2DAK _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DAK _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.84mM UBA domain U-15N, 13C; 20mM d-Tris-HCl (pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_refine.entry_id 2DAK _pdbx_nmr_refine.method 'torsion angle dynamics, restrainted molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.6 'Bruker Bruker' 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B. A.' 3 'data analysis' KUJIRA 0.9321 'Kobayashi, N.' 4 'structure solution' CYANA 1.0.8 'Guntert, P.' 5 refinement CYANA 1.0.8 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 VAL N N N N 345 VAL CA C N S 346 VAL C C N N 347 VAL O O N N 348 VAL CB C N N 349 VAL CG1 C N N 350 VAL CG2 C N N 351 VAL OXT O N N 352 VAL H H N N 353 VAL H2 H N N 354 VAL HA H N N 355 VAL HB H N N 356 VAL HG11 H N N 357 VAL HG12 H N N 358 VAL HG13 H N N 359 VAL HG21 H N N 360 VAL HG22 H N N 361 VAL HG23 H N N 362 VAL HXT H N N 363 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 VAL N CA sing N N 332 VAL N H sing N N 333 VAL N H2 sing N N 334 VAL CA C sing N N 335 VAL CA CB sing N N 336 VAL CA HA sing N N 337 VAL C O doub N N 338 VAL C OXT sing N N 339 VAL CB CG1 sing N N 340 VAL CB CG2 sing N N 341 VAL CB HB sing N N 342 VAL CG1 HG11 sing N N 343 VAL CG1 HG12 sing N N 344 VAL CG1 HG13 sing N N 345 VAL CG2 HG21 sing N N 346 VAL CG2 HG22 sing N N 347 VAL CG2 HG23 sing N N 348 VAL OXT HXT sing N N 349 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2DAK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_