data_2DAN # _entry.id 2DAN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DAN pdb_00002dan 10.2210/pdb2dan/pdb RCSB RCSB025190 ? ? WWPDB D_1000025190 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2D8Q 'the same protein domain of the different length' unspecified TargetDB hss001004006.1 . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DAN _pdbx_database_status.recvd_initial_deposition_date 2005-12-14 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sasagawa, A.' 1 'Miyamoto, K.' 2 'Tochio, N.' 3 'Koshiba, S.' 4 'Inoue, M.' 5 'Kigawa, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title ;The solution structure of the MYND domain (LEU384-CYS430) of human Zinc finger MYND domain containing protein 10 ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sasagawa, A.' 1 ? primary 'Miyamoto, K.' 2 ? primary 'Tochio, N.' 3 ? primary 'Koshiba, S.' 4 ? primary 'Inoue, M.' 5 ? primary 'Kigawa, T.' 6 ? primary 'Yokoyama, S.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Zinc finger MYND domain containing protein 10' 6538.294 1 ? ? 'MYND domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'BLu protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGLEAVAPERPRCAYCSAEASKRCSRCQNEWYCCRECQVKHWEKHGKTCSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGLEAVAPERPRCAYCSAEASKRCSRCQNEWYCCRECQVKHWEKHGKTCSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hss001004006.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 LEU n 1 9 GLU n 1 10 ALA n 1 11 VAL n 1 12 ALA n 1 13 PRO n 1 14 GLU n 1 15 ARG n 1 16 PRO n 1 17 ARG n 1 18 CYS n 1 19 ALA n 1 20 TYR n 1 21 CYS n 1 22 SER n 1 23 ALA n 1 24 GLU n 1 25 ALA n 1 26 SER n 1 27 LYS n 1 28 ARG n 1 29 CYS n 1 30 SER n 1 31 ARG n 1 32 CYS n 1 33 GLN n 1 34 ASN n 1 35 GLU n 1 36 TRP n 1 37 TYR n 1 38 CYS n 1 39 CYS n 1 40 ARG n 1 41 GLU n 1 42 CYS n 1 43 GLN n 1 44 VAL n 1 45 LYS n 1 46 HIS n 1 47 TRP n 1 48 GLU n 1 49 LYS n 1 50 HIS n 1 51 GLY n 1 52 LYS n 1 53 THR n 1 54 CYS n 1 55 SER n 1 56 GLY n 1 57 PRO n 1 58 SER n 1 59 SER n 1 60 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ZMYND10 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cell free synthesis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050302-43 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZMY10_HUMAN _struct_ref.pdbx_db_accession O75800 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 384 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DAN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 54 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O75800 _struct_ref_seq.db_align_beg 384 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 430 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 54 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DAN GLY A 1 ? UNP O75800 ? ? 'cloning artifact' 1 1 1 2DAN SER A 2 ? UNP O75800 ? ? 'cloning artifact' 2 2 1 2DAN SER A 3 ? UNP O75800 ? ? 'cloning artifact' 3 3 1 2DAN GLY A 4 ? UNP O75800 ? ? 'cloning artifact' 4 4 1 2DAN SER A 5 ? UNP O75800 ? ? 'cloning artifact' 5 5 1 2DAN SER A 6 ? UNP O75800 ? ? 'cloning artifact' 6 6 1 2DAN GLY A 7 ? UNP O75800 ? ? 'cloning artifact' 7 7 1 2DAN SER A 55 ? UNP O75800 ? ? 'cloning artifact' 55 8 1 2DAN GLY A 56 ? UNP O75800 ? ? 'cloning artifact' 56 9 1 2DAN PRO A 57 ? UNP O75800 ? ? 'cloning artifact' 57 10 1 2DAN SER A 58 ? UNP O75800 ? ? 'cloning artifact' 58 11 1 2DAN SER A 59 ? UNP O75800 ? ? 'cloning artifact' 59 12 1 2DAN GLY A 60 ? UNP O75800 ? ? 'cloning artifact' 60 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1.31mM zf-MYND domain U-15N,13C; 20mM d-Tris-HCL; 100mM Nacl; 1mM d-DTT; 0.02% NaM3; 50uM ZnCl2; 1mM IDA; 90% H2O, 10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 900 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2DAN _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2DAN _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DAN _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy, fewest violations' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMNMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.933 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2DAN _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2DAN _struct.title 'The solution structure of the MYND domain (LEU384-CYS430) of human Zinc finger MYND domain containing protein 10' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DAN _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text ;zf-MYND, BLu protein, C3H, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 39 ? HIS A 46 ? CYS A 39 HIS A 46 1 ? 8 HELX_P HELX_P2 2 HIS A 46 ? GLY A 51 ? HIS A 46 GLY A 51 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 18 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 18 A ZN 401 1_555 ? ? ? ? ? ? ? 2.375 ? ? metalc2 metalc ? ? A CYS 21 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 21 A ZN 401 1_555 ? ? ? ? ? ? ? 2.328 ? ? metalc3 metalc ? ? A CYS 29 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 29 A ZN 201 1_555 ? ? ? ? ? ? ? 2.345 ? ? metalc4 metalc ? ? A CYS 32 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 32 A ZN 201 1_555 ? ? ? ? ? ? ? 2.322 ? ? metalc5 metalc ? ? A CYS 38 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 38 A ZN 401 1_555 ? ? ? ? ? ? ? 2.327 ? ? metalc6 metalc ? ? A CYS 42 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 42 A ZN 401 1_555 ? ? ? ? ? ? ? 2.331 ? ? metalc7 metalc ? ? A HIS 50 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 50 A ZN 201 1_555 ? ? ? ? ? ? ? 2.337 ? ? metalc8 metalc ? ? A CYS 54 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 54 A ZN 201 1_555 ? ? ? ? ? ? ? 2.321 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 27 ? ARG A 28 ? LYS A 27 ARG A 28 A 2 TRP A 36 ? TYR A 37 ? TRP A 36 TYR A 37 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 27 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 27 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id TYR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 37 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 37 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 5 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 CYS A 29 ? CYS A 29 . ? 1_555 ? 2 AC1 5 ARG A 31 ? ARG A 31 . ? 1_555 ? 3 AC1 5 CYS A 32 ? CYS A 32 . ? 1_555 ? 4 AC1 5 HIS A 50 ? HIS A 50 . ? 1_555 ? 5 AC1 5 CYS A 54 ? CYS A 54 . ? 1_555 ? 6 AC2 4 CYS A 18 ? CYS A 18 . ? 1_555 ? 7 AC2 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 8 AC2 4 CYS A 38 ? CYS A 38 . ? 1_555 ? 9 AC2 4 CYS A 42 ? CYS A 42 . ? 1_555 ? # _database_PDB_matrix.entry_id 2DAN _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DAN _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 TRP 36 36 36 TRP TRP A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 TRP 47 47 47 TRP TRP A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 HIS 50 50 50 HIS HIS A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 GLY 60 60 60 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 21 ? A CYS 21 ? 1_555 104.9 ? 2 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 38 ? A CYS 38 ? 1_555 117.0 ? 3 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 38 ? A CYS 38 ? 1_555 99.8 ? 4 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 98.4 ? 5 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 118.3 ? 6 SG ? A CYS 38 ? A CYS 38 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 118.5 ? 7 SG ? A CYS 29 ? A CYS 29 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 32 ? A CYS 32 ? 1_555 117.1 ? 8 SG ? A CYS 29 ? A CYS 29 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 50 ? A HIS 50 ? 1_555 89.2 ? 9 SG ? A CYS 32 ? A CYS 32 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 50 ? A HIS 50 ? 1_555 97.1 ? 10 SG ? A CYS 29 ? A CYS 29 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 54 ? A CYS 54 ? 1_555 118.3 ? 11 SG ? A CYS 32 ? A CYS 32 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 54 ? A CYS 54 ? 1_555 119.2 ? 12 NE2 ? A HIS 50 ? A HIS 50 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 54 ? A CYS 54 ? 1_555 106.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-06-14 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_conn_angle 6 4 'Structure model' pdbx_struct_oper_list 7 4 'Structure model' struct_conn 8 4 'Structure model' struct_ref_seq_dif 9 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.value' 18 4 'Structure model' '_struct_conn.pdbx_dist_value' 19 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 20 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 24 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 25 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 26 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 29 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 30 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 31 4 'Structure model' '_struct_ref_seq_dif.details' 32 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 33 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 34 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 10 ? ? -63.66 94.43 2 1 PRO A 13 ? ? -69.71 -163.59 3 1 PRO A 16 ? ? -69.78 -163.82 4 1 GLU A 24 ? ? -41.65 109.93 5 1 CYS A 54 ? ? -46.02 164.83 6 1 PRO A 57 ? ? -69.77 80.78 7 1 SER A 58 ? ? -37.19 136.80 8 1 SER A 59 ? ? -173.74 145.39 9 2 LEU A 8 ? ? -106.95 40.56 10 2 PRO A 13 ? ? -69.79 -163.64 11 2 PRO A 16 ? ? -69.80 -163.46 12 2 GLU A 24 ? ? -43.29 109.27 13 2 GLU A 48 ? ? -36.02 -30.44 14 2 CYS A 54 ? ? -46.57 165.66 15 2 PRO A 57 ? ? -69.77 4.98 16 2 SER A 59 ? ? -62.37 88.92 17 3 PRO A 13 ? ? -69.79 -164.73 18 3 PRO A 16 ? ? -69.73 -163.40 19 3 GLU A 24 ? ? -44.67 109.63 20 3 GLU A 48 ? ? -36.56 -35.03 21 3 CYS A 54 ? ? -48.89 166.33 22 3 PRO A 57 ? ? -69.75 -171.71 23 3 SER A 59 ? ? -51.60 95.97 24 4 SER A 3 ? ? -92.25 42.17 25 4 ALA A 10 ? ? -45.63 98.56 26 4 PRO A 13 ? ? -69.76 -164.56 27 4 PRO A 16 ? ? -69.73 -163.88 28 4 GLU A 48 ? ? -36.21 -33.79 29 4 CYS A 54 ? ? -48.20 165.71 30 5 LEU A 8 ? ? 35.92 39.72 31 5 GLU A 9 ? ? -55.54 92.65 32 5 PRO A 13 ? ? -69.73 -163.70 33 5 PRO A 16 ? ? -69.75 -164.01 34 5 GLU A 48 ? ? -36.16 -36.92 35 5 SER A 58 ? ? -175.54 148.13 36 6 PRO A 16 ? ? -69.73 -163.37 37 6 GLU A 24 ? ? -44.78 107.73 38 6 GLU A 48 ? ? -36.27 -37.02 39 6 CYS A 54 ? ? -47.53 167.83 40 6 SER A 58 ? ? -103.26 46.12 41 7 SER A 5 ? ? -82.97 41.05 42 7 LEU A 8 ? ? -103.81 41.54 43 7 PRO A 16 ? ? -69.78 -163.76 44 7 GLU A 48 ? ? -36.05 -30.92 45 7 CYS A 54 ? ? -49.91 166.23 46 7 PRO A 57 ? ? -69.74 -167.57 47 8 SER A 2 ? ? -107.32 41.27 48 8 LEU A 8 ? ? -53.47 98.82 49 8 PRO A 13 ? ? -69.70 -163.99 50 8 PRO A 16 ? ? -69.80 -163.86 51 8 GLU A 24 ? ? -52.63 108.22 52 8 GLU A 48 ? ? -35.95 -36.61 53 9 PRO A 16 ? ? -69.76 -163.73 54 9 GLU A 24 ? ? -47.22 109.54 55 9 GLU A 48 ? ? -35.96 -30.48 56 9 CYS A 54 ? ? -47.79 167.62 57 9 PRO A 57 ? ? -69.82 81.59 58 10 LEU A 8 ? ? -36.13 98.24 59 10 PRO A 13 ? ? -69.77 -164.23 60 10 PRO A 16 ? ? -69.75 -164.12 61 10 GLU A 48 ? ? -36.23 -38.25 62 10 CYS A 54 ? ? -48.68 165.85 63 11 SER A 6 ? ? -166.49 106.98 64 11 PRO A 16 ? ? -69.77 -164.04 65 11 GLU A 24 ? ? -47.01 109.08 66 11 CYS A 54 ? ? -48.54 165.88 67 11 SER A 58 ? ? -34.17 146.27 68 12 SER A 6 ? ? -160.00 113.84 69 12 LEU A 8 ? ? -81.24 42.06 70 12 PRO A 16 ? ? -69.75 -163.50 71 12 GLU A 24 ? ? -42.72 109.72 72 12 GLU A 48 ? ? -36.10 -33.43 73 12 CYS A 54 ? ? -48.12 166.85 74 12 PRO A 57 ? ? -69.79 79.83 75 12 SER A 58 ? ? -134.83 -46.69 76 13 SER A 5 ? ? -50.69 104.63 77 13 PRO A 13 ? ? -69.78 -163.25 78 13 PRO A 16 ? ? -69.79 -163.80 79 13 GLU A 24 ? ? -47.02 108.69 80 13 GLU A 48 ? ? -36.20 -35.43 81 13 CYS A 54 ? ? -49.07 169.38 82 14 PRO A 13 ? ? -69.78 -163.75 83 14 PRO A 16 ? ? -69.75 -163.61 84 14 GLU A 24 ? ? -42.53 109.89 85 14 GLU A 48 ? ? -36.10 -35.45 86 14 CYS A 54 ? ? -49.65 164.73 87 15 SER A 5 ? ? -95.28 40.52 88 15 LEU A 8 ? ? -51.82 93.19 89 15 PRO A 13 ? ? -69.75 -165.43 90 15 PRO A 16 ? ? -69.76 -163.46 91 15 GLU A 24 ? ? -42.85 109.73 92 15 GLU A 48 ? ? -36.55 -31.87 93 15 CYS A 54 ? ? -46.84 165.63 94 15 PRO A 57 ? ? -69.79 81.41 95 15 SER A 58 ? ? 35.78 42.62 96 16 LEU A 8 ? ? -34.75 100.50 97 16 ALA A 10 ? ? -61.15 94.72 98 16 PRO A 13 ? ? -69.72 -168.57 99 16 PRO A 16 ? ? -69.76 -163.61 100 16 GLU A 24 ? ? -47.82 109.49 101 16 SER A 26 ? ? -131.87 -37.33 102 16 GLU A 48 ? ? -36.02 -38.08 103 16 SER A 58 ? ? -63.05 85.70 104 17 PRO A 13 ? ? -69.76 -163.20 105 17 PRO A 16 ? ? -69.77 -163.24 106 17 GLU A 24 ? ? -48.88 107.08 107 17 GLU A 48 ? ? -36.19 -30.55 108 17 CYS A 54 ? ? -48.22 169.73 109 18 PRO A 13 ? ? -69.78 -163.90 110 18 PRO A 16 ? ? -69.80 -163.93 111 18 GLU A 48 ? ? -36.26 -38.74 112 18 CYS A 54 ? ? -47.84 167.27 113 19 SER A 6 ? ? -53.12 178.41 114 19 GLU A 9 ? ? -171.90 144.58 115 19 ALA A 10 ? ? -46.43 97.68 116 19 PRO A 16 ? ? -69.76 -163.30 117 19 GLU A 24 ? ? -42.23 109.74 118 19 GLU A 48 ? ? -35.90 -34.18 119 19 SER A 59 ? ? -124.17 -59.91 120 20 SER A 2 ? ? -100.79 67.23 121 20 PRO A 13 ? ? -69.73 -165.29 122 20 PRO A 16 ? ? -69.70 -164.25 123 20 GLU A 24 ? ? -38.64 109.22 124 20 CYS A 54 ? ? -47.31 166.94 125 20 PRO A 57 ? ? -69.74 80.24 126 20 SER A 59 ? ? -90.88 42.08 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #