data_2DBM # _entry.id 2DBM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DBM pdb_00002dbm 10.2210/pdb2dbm/pdb RCSB RCSB025221 ? ? WWPDB D_1000025221 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DBM _pdbx_database_status.recvd_initial_deposition_date 2005-12-15 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sato, M.' 1 'Koshiba, S.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Yokoyama, S.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title 'Solution structures of the SH3 domain of human SH3-containing GRB2-like protein 2' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sato, M.' 1 ? primary 'Koshiba, S.' 2 ? primary 'Inoue, M.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Yokoyama, S.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'SH3-containing GRB2-like protein 2' _entity.formula_weight 7880.576 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.3.1.- _entity.pdbx_mutation ? _entity.pdbx_fragment 'SH3 domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'SH3 domain protein 2A, Endophilin 1, EEN-B1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVALPHSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVALPHSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 PRO n 1 9 CYS n 1 10 CYS n 1 11 ARG n 1 12 ALA n 1 13 LEU n 1 14 TYR n 1 15 ASP n 1 16 PHE n 1 17 GLU n 1 18 PRO n 1 19 GLU n 1 20 ASN n 1 21 GLU n 1 22 GLY n 1 23 GLU n 1 24 LEU n 1 25 GLY n 1 26 PHE n 1 27 LYS n 1 28 GLU n 1 29 GLY n 1 30 ASP n 1 31 ILE n 1 32 ILE n 1 33 THR n 1 34 LEU n 1 35 THR n 1 36 ASN n 1 37 GLN n 1 38 ILE n 1 39 ASP n 1 40 GLU n 1 41 ASN n 1 42 TRP n 1 43 TYR n 1 44 GLU n 1 45 GLY n 1 46 MET n 1 47 LEU n 1 48 HIS n 1 49 GLY n 1 50 HIS n 1 51 SER n 1 52 GLY n 1 53 PHE n 1 54 PHE n 1 55 PRO n 1 56 ILE n 1 57 ASN n 1 58 TYR n 1 59 VAL n 1 60 GLU n 1 61 ILE n 1 62 LEU n 1 63 VAL n 1 64 ALA n 1 65 LEU n 1 66 PRO n 1 67 HIS n 1 68 SER n 1 69 GLY n 1 70 PRO n 1 71 SER n 1 72 SER n 1 73 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene SH3GL2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050620-01 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SH3G2_HUMAN _struct_ref.pdbx_db_accession Q99962 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code PCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVALPH _struct_ref.pdbx_align_begin 293 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DBM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 67 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q99962 _struct_ref_seq.db_align_beg 293 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 352 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 67 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DBM GLY A 1 ? UNP Q99962 ? ? 'cloning artifact' 1 1 1 2DBM SER A 2 ? UNP Q99962 ? ? 'cloning artifact' 2 2 1 2DBM SER A 3 ? UNP Q99962 ? ? 'cloning artifact' 3 3 1 2DBM GLY A 4 ? UNP Q99962 ? ? 'cloning artifact' 4 4 1 2DBM SER A 5 ? UNP Q99962 ? ? 'cloning artifact' 5 5 1 2DBM SER A 6 ? UNP Q99962 ? ? 'cloning artifact' 6 6 1 2DBM GLY A 7 ? UNP Q99962 ? ? 'cloning artifact' 7 7 1 2DBM SER A 68 ? UNP Q99962 ? ? 'cloning artifact' 68 8 1 2DBM GLY A 69 ? UNP Q99962 ? ? 'cloning artifact' 69 9 1 2DBM PRO A 70 ? UNP Q99962 ? ? 'cloning artifact' 70 10 1 2DBM SER A 71 ? UNP Q99962 ? ? 'cloning artifact' 71 11 1 2DBM SER A 72 ? UNP Q99962 ? ? 'cloning artifact' 72 12 1 2DBM GLY A 73 ? UNP Q99962 ? ? 'cloning artifact' 73 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1mM SH3 domain U-15N,13C; 20mM d-Tris HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2DBM _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2DBM _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DBM _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.932 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2DBM _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2DBM _struct.title 'Solution structures of the SH3 domain of human SH3-containing GRB2-like protein 2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DBM _struct_keywords.pdbx_keywords 'TRANSFERASE, SIGNALING PROTEIN' _struct_keywords.text ;EC 2.3.1.-, SH3 domain protein 2A, Endophilin 1, EEN-B1, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE, SIGNALING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 31 ? THR A 33 ? ILE A 31 THR A 33 A 2 CYS A 9 ? ALA A 12 ? CYS A 9 ALA A 12 A 3 VAL A 59 ? ILE A 61 ? VAL A 59 ILE A 61 B 1 TRP A 42 ? LEU A 47 ? TRP A 42 LEU A 47 B 2 HIS A 50 ? PRO A 55 ? HIS A 50 PRO A 55 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ILE A 32 ? O ILE A 32 N CYS A 10 ? N CYS A 10 A 2 3 N ARG A 11 ? N ARG A 11 O GLU A 60 ? O GLU A 60 B 1 2 N LEU A 47 ? N LEU A 47 O HIS A 50 ? O HIS A 50 # _database_PDB_matrix.entry_id 2DBM _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DBM _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 TRP 42 42 42 TRP TRP A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 HIS 50 50 50 HIS HIS A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 HIS 67 67 67 HIS HIS A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 GLY 73 73 73 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-12-19 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 23 ? ? -35.12 137.02 2 1 GLU A 28 ? ? -42.41 108.63 3 1 THR A 35 ? ? -122.37 -50.98 4 1 SER A 72 ? ? -38.58 105.74 5 2 GLU A 28 ? ? -39.95 132.14 6 2 SER A 68 ? ? -98.01 -64.17 7 3 SER A 5 ? ? -132.70 -50.03 8 3 THR A 35 ? ? -133.22 -49.80 9 3 LEU A 65 ? ? -47.76 150.28 10 3 PRO A 70 ? ? -69.70 91.92 11 3 SER A 72 ? ? -60.05 91.54 12 4 THR A 35 ? ? -126.48 -55.01 13 4 LEU A 65 ? ? -48.51 153.88 14 4 SER A 68 ? ? -90.93 51.80 15 5 SER A 5 ? ? -47.20 172.57 16 5 GLU A 21 ? ? -44.17 154.75 17 5 LEU A 65 ? ? -47.30 159.33 18 6 THR A 33 ? ? -47.53 158.14 19 6 THR A 35 ? ? -125.42 -54.49 20 6 LEU A 65 ? ? -47.80 157.26 21 6 PRO A 66 ? ? -69.72 2.83 22 7 SER A 6 ? ? -47.51 169.38 23 7 THR A 33 ? ? -45.77 159.40 24 7 THR A 35 ? ? -121.19 -54.40 25 7 LEU A 65 ? ? -49.68 157.70 26 8 GLU A 28 ? ? -52.55 108.93 27 8 THR A 35 ? ? -130.62 -51.55 28 8 LEU A 65 ? ? -46.99 152.06 29 8 SER A 72 ? ? -46.83 106.79 30 9 SER A 3 ? ? -48.47 101.22 31 9 THR A 33 ? ? -48.23 153.50 32 9 THR A 35 ? ? -120.20 -55.32 33 9 LEU A 65 ? ? -48.87 153.08 34 9 PRO A 70 ? ? -69.74 86.71 35 10 SER A 6 ? ? -132.97 -45.18 36 10 GLU A 28 ? ? -34.48 133.08 37 10 LEU A 65 ? ? -48.49 159.16 38 10 SER A 68 ? ? -100.41 -63.86 39 10 SER A 71 ? ? -103.48 45.71 40 10 SER A 72 ? ? -48.19 168.60 41 11 GLU A 21 ? ? -42.11 161.19 42 11 LEU A 65 ? ? -48.47 152.41 43 12 THR A 35 ? ? -125.06 -54.34 44 12 PRO A 66 ? ? -69.72 98.63 45 12 SER A 72 ? ? -56.10 98.42 46 13 LEU A 65 ? ? -47.63 156.14 47 13 PRO A 66 ? ? -69.73 2.51 48 14 SER A 2 ? ? -37.87 147.78 49 14 HIS A 67 ? ? -51.71 105.48 50 15 THR A 35 ? ? -130.71 -43.82 51 15 HIS A 48 ? ? 47.57 29.83 52 15 PRO A 70 ? ? -69.73 97.62 53 16 SER A 6 ? ? -160.37 110.48 54 16 GLU A 21 ? ? -58.01 174.54 55 16 LEU A 65 ? ? -47.02 154.05 56 16 PRO A 66 ? ? -69.66 89.13 57 16 PRO A 70 ? ? -69.69 90.35 58 17 SER A 2 ? ? -93.13 55.15 59 17 SER A 3 ? ? -163.79 111.61 60 17 THR A 35 ? ? -122.66 -54.99 61 17 LEU A 65 ? ? -47.77 154.05 62 17 PRO A 70 ? ? -69.74 95.54 63 18 GLU A 28 ? ? -38.34 131.96 64 18 THR A 35 ? ? -130.43 -54.48 65 18 LEU A 65 ? ? -48.99 157.36 66 18 SER A 68 ? ? -49.29 175.33 67 19 GLU A 28 ? ? -34.56 128.40 68 19 PRO A 70 ? ? -69.79 92.22 69 20 GLU A 23 ? ? -37.36 137.78 70 20 THR A 35 ? ? -124.81 -55.46 71 20 PRO A 66 ? ? -69.70 99.60 72 20 SER A 68 ? ? -126.07 -54.33 #