data_2DG7 # _entry.id 2DG7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2DG7 RCSB RCSB025380 WWPDB D_1000025380 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1QPI _pdbx_database_related.details 'A protein structure which is categorized into the same family' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DG7 _pdbx_database_status.recvd_initial_deposition_date 2006-03-08 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hayashi, T.' 1 'Tanaka, Y.' 2 'Sakai, N.' 3 'Yao, M.' 4 'Tamura, T.' 5 'Tanaka, I.' 6 # _citation.id primary _citation.title 'Crystal structure of the putative transcriptional regulator SCO0337 from Streptomyces coelicolor A3(2)' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Hayashi, T.' 1 primary 'Tanaka, Y.' 2 primary 'Sakai, N.' 3 primary 'Yao, M.' 4 primary 'Tamura, T.' 5 primary 'Tanaka, I.' 6 # _cell.entry_id 2DG7 _cell.length_a 102.952 _cell.length_b 42.864 _cell.length_c 43.933 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2DG7 _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'putative transcriptional regulator' 21442.734 1 ? ? ? ? 2 water nat water 18.015 55 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)ARWDPGAEQRLKRAALELYSEHGYDNVTVTDIAERAGLTRRSYFRYFPDKREVLFGGSELLPPAVARAVLAADPG AAPLTAVLDA(MSE)SQVGAQLVAQVEGAAQRRAVIDASPELQERERTKSAAISRAVQDALVRRQVDADTAELVAQLATV AFGSAFRRWIDAEGHADFGSCLDTVTDRLRAVLTGLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MARWDPGAEQRLKRAALELYSEHGYDNVTVTDIAERAGLTRRSYFRYFPDKREVLFGGSELLPPAVARAVLAADPGAAPL TAVLDAMSQVGAQLVAQVEGAAQRRAVIDASPELQERERTKSAAISRAVQDALVRRQVDADTAELVAQLATVAFGSAFRR WIDAEGHADFGSCLDTVTDRLRAVLTGLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ALA n 1 3 ARG n 1 4 TRP n 1 5 ASP n 1 6 PRO n 1 7 GLY n 1 8 ALA n 1 9 GLU n 1 10 GLN n 1 11 ARG n 1 12 LEU n 1 13 LYS n 1 14 ARG n 1 15 ALA n 1 16 ALA n 1 17 LEU n 1 18 GLU n 1 19 LEU n 1 20 TYR n 1 21 SER n 1 22 GLU n 1 23 HIS n 1 24 GLY n 1 25 TYR n 1 26 ASP n 1 27 ASN n 1 28 VAL n 1 29 THR n 1 30 VAL n 1 31 THR n 1 32 ASP n 1 33 ILE n 1 34 ALA n 1 35 GLU n 1 36 ARG n 1 37 ALA n 1 38 GLY n 1 39 LEU n 1 40 THR n 1 41 ARG n 1 42 ARG n 1 43 SER n 1 44 TYR n 1 45 PHE n 1 46 ARG n 1 47 TYR n 1 48 PHE n 1 49 PRO n 1 50 ASP n 1 51 LYS n 1 52 ARG n 1 53 GLU n 1 54 VAL n 1 55 LEU n 1 56 PHE n 1 57 GLY n 1 58 GLY n 1 59 SER n 1 60 GLU n 1 61 LEU n 1 62 LEU n 1 63 PRO n 1 64 PRO n 1 65 ALA n 1 66 VAL n 1 67 ALA n 1 68 ARG n 1 69 ALA n 1 70 VAL n 1 71 LEU n 1 72 ALA n 1 73 ALA n 1 74 ASP n 1 75 PRO n 1 76 GLY n 1 77 ALA n 1 78 ALA n 1 79 PRO n 1 80 LEU n 1 81 THR n 1 82 ALA n 1 83 VAL n 1 84 LEU n 1 85 ASP n 1 86 ALA n 1 87 MSE n 1 88 SER n 1 89 GLN n 1 90 VAL n 1 91 GLY n 1 92 ALA n 1 93 GLN n 1 94 LEU n 1 95 VAL n 1 96 ALA n 1 97 GLN n 1 98 VAL n 1 99 GLU n 1 100 GLY n 1 101 ALA n 1 102 ALA n 1 103 GLN n 1 104 ARG n 1 105 ARG n 1 106 ALA n 1 107 VAL n 1 108 ILE n 1 109 ASP n 1 110 ALA n 1 111 SER n 1 112 PRO n 1 113 GLU n 1 114 LEU n 1 115 GLN n 1 116 GLU n 1 117 ARG n 1 118 GLU n 1 119 ARG n 1 120 THR n 1 121 LYS n 1 122 SER n 1 123 ALA n 1 124 ALA n 1 125 ILE n 1 126 SER n 1 127 ARG n 1 128 ALA n 1 129 VAL n 1 130 GLN n 1 131 ASP n 1 132 ALA n 1 133 LEU n 1 134 VAL n 1 135 ARG n 1 136 ARG n 1 137 GLN n 1 138 VAL n 1 139 ASP n 1 140 ALA n 1 141 ASP n 1 142 THR n 1 143 ALA n 1 144 GLU n 1 145 LEU n 1 146 VAL n 1 147 ALA n 1 148 GLN n 1 149 LEU n 1 150 ALA n 1 151 THR n 1 152 VAL n 1 153 ALA n 1 154 PHE n 1 155 GLY n 1 156 SER n 1 157 ALA n 1 158 PHE n 1 159 ARG n 1 160 ARG n 1 161 TRP n 1 162 ILE n 1 163 ASP n 1 164 ALA n 1 165 GLU n 1 166 GLY n 1 167 HIS n 1 168 ALA n 1 169 ASP n 1 170 PHE n 1 171 GLY n 1 172 SER n 1 173 CYS n 1 174 LEU n 1 175 ASP n 1 176 THR n 1 177 VAL n 1 178 THR n 1 179 ASP n 1 180 ARG n 1 181 LEU n 1 182 ARG n 1 183 ALA n 1 184 VAL n 1 185 LEU n 1 186 THR n 1 187 GLY n 1 188 LEU n 1 189 GLU n 1 190 HIS n 1 191 HIS n 1 192 HIS n 1 193 HIS n 1 194 HIS n 1 195 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Streptomyces _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species 'Streptomyces coelicolor' _entity_src_gen.gene_src_strain 'A3(2)' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces coelicolor' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 100226 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Rhodococcus erythropolis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 1833 _entity_src_gen.host_org_genus Rhodococcus _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain L-88 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pTip-QC2 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name GB _struct_ref.db_code CAB56142 _struct_ref.pdbx_db_accession 5912516 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MARWDPGAEQRLKRAALELYSEHGYDNVTVTDIAERAGLTRRSYFRYFPDKREVLFGGSELLPPAVARAVLAADPGAAPL TAVLDAMSQVGAQLVAQVEGAAQRRAVIDASPELQERERTKSAAISRAVQDALVRRQVDADTAELVAQLATVAFGSAFRR WIDAEGHADFGSCLDTVTDRLRAVLTG ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DG7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 187 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 5912516 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 187 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 187 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DG7 MSE A 1 ? GB 5912516 MET 1 'MODIFIED RESIDUE' 1 1 1 2DG7 MSE A 87 ? GB 5912516 MET 87 'MODIFIED RESIDUE' 87 2 1 2DG7 LEU A 188 ? GB 5912516 ? ? 'EXPRESSION TAG' 188 3 1 2DG7 GLU A 189 ? GB 5912516 ? ? 'EXPRESSION TAG' 189 4 1 2DG7 HIS A 190 ? GB 5912516 ? ? 'EXPRESSION TAG' 190 5 1 2DG7 HIS A 191 ? GB 5912516 ? ? 'EXPRESSION TAG' 191 6 1 2DG7 HIS A 192 ? GB 5912516 ? ? 'EXPRESSION TAG' 192 7 1 2DG7 HIS A 193 ? GB 5912516 ? ? 'EXPRESSION TAG' 193 8 1 2DG7 HIS A 194 ? GB 5912516 ? ? 'EXPRESSION TAG' 194 9 1 2DG7 HIS A 195 ? GB 5912516 ? ? 'EXPRESSION TAG' 195 10 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2DG7 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.26 _exptl_crystal.density_percent_sol 45.57 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pdbx_details '100mM HEPES pH7.0, 9% Jeffamine ED-2001 reagent pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2005-12-11 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.97934 1.0 2 0.97950 1.0 3 0.98338 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'PHOTON FACTORY BEAMLINE BL-5A' _diffrn_source.pdbx_synchrotron_site 'Photon Factory' _diffrn_source.pdbx_synchrotron_beamline BL-5A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.97934, 0.97950, 0.98338' # _reflns.entry_id 2DG7 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50 _reflns.d_resolution_high 2.3 _reflns.number_obs 9138 _reflns.number_all ? _reflns.percent_possible_obs 99.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.049 _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate 24.1 _reflns.pdbx_redundancy 10.2 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.30 _reflns_shell.d_res_low 2.38 _reflns_shell.percent_possible_all 97.9 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.204 _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy 9.4 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 872 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2DG7 _refine.ls_number_reflns_obs 8970 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 1105378.10 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 9.98 _refine.ls_d_res_high 2.30 _refine.ls_percent_reflns_obs 99.6 _refine.ls_R_factor_obs 0.23 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.23 _refine.ls_R_factor_R_free 0.276 _refine.ls_R_factor_R_free_error 0.009 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.8 _refine.ls_number_reflns_R_free 879 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 38.7 _refine.aniso_B[1][1] -1.37 _refine.aniso_B[2][2] 7.95 _refine.aniso_B[3][3] -6.58 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.553281 _refine.solvent_model_param_bsol 65.8184 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2DG7 _refine_analyze.Luzzati_coordinate_error_obs 0.27 _refine_analyze.Luzzati_sigma_a_obs 0.11 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.35 _refine_analyze.Luzzati_sigma_a_free 0.21 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1426 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 55 _refine_hist.number_atoms_total 1481 _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 9.98 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.003 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 0.9 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 19.1 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.59 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.52 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 2.54 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 2.41 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 3.72 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.30 _refine_ls_shell.d_res_low 2.44 _refine_ls_shell.number_reflns_R_work 1285 _refine_ls_shell.R_factor_R_work 0.22 _refine_ls_shell.percent_reflns_obs 98.6 _refine_ls_shell.R_factor_R_free 0.28 _refine_ls_shell.R_factor_R_free_error 0.022 _refine_ls_shell.percent_reflns_R_free 11.3 _refine_ls_shell.number_reflns_R_free 164 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 2 water_rep.param water.top 'X-RAY DIFFRACTION' # _struct.entry_id 2DG7 _struct.title 'Crystal structure of the putative transcriptional regulator SCO0337 from Streptomyces coelicolor A3(2)' _struct.pdbx_descriptor 'putative transcriptional regulator' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DG7 _struct_keywords.pdbx_keywords 'GENE REGULATION' _struct_keywords.text 'helix-turn-helix motif, TetR family, GENE REGULATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details 'The biological assembly is a dimer generated from the monomer in the asymmetric unit by the operations: -x+1, -y+1, z.' _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 7 ? HIS A 23 ? GLY A 7 HIS A 23 1 ? 17 HELX_P HELX_P2 2 GLY A 24 ? VAL A 28 ? GLY A 24 VAL A 28 5 ? 5 HELX_P HELX_P3 3 THR A 29 ? ALA A 37 ? THR A 29 ALA A 37 1 ? 9 HELX_P HELX_P4 4 THR A 40 ? PHE A 48 ? THR A 40 PHE A 48 1 ? 9 HELX_P HELX_P5 5 ARG A 52 ? PHE A 56 ? ARG A 52 PHE A 56 5 ? 5 HELX_P HELX_P6 6 LEU A 62 ? ALA A 72 ? LEU A 62 ALA A 72 1 ? 11 HELX_P HELX_P7 7 ALA A 78 ? GLY A 91 ? ALA A 78 GLY A 91 1 ? 14 HELX_P HELX_P8 8 GLY A 100 ? ALA A 110 ? GLY A 100 ALA A 110 1 ? 11 HELX_P HELX_P9 9 SER A 111 ? ARG A 136 ? SER A 111 ARG A 136 1 ? 26 HELX_P HELX_P10 10 ASP A 139 ? ALA A 164 ? ASP A 139 ALA A 164 1 ? 26 HELX_P HELX_P11 11 ASP A 169 ? GLY A 187 ? ASP A 169 GLY A 187 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A MSE 1 C ? ? ? 1_555 A ALA 2 N ? ? A MSE 1 A ALA 2 1_555 ? ? ? ? ? ? ? 1.328 ? covale2 covale ? ? A ALA 86 C ? ? ? 1_555 A MSE 87 N ? ? A ALA 86 A MSE 87 1_555 ? ? ? ? ? ? ? 1.328 ? covale3 covale ? ? A MSE 87 C ? ? ? 1_555 A SER 88 N ? ? A MSE 87 A SER 88 1_555 ? ? ? ? ? ? ? 1.329 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 2DG7 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DG7 _atom_sites.fract_transf_matrix[1][1] 0.009713 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023330 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.022762 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 TRP 4 4 4 TRP TRP A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 MSE 87 87 87 MSE MSE A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 GLN 103 103 103 GLN GLN A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 PRO 112 112 112 PRO PRO A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 ILE 125 125 125 ILE ILE A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 GLN 130 130 130 GLN GLN A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 ARG 135 135 135 ARG ARG A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 GLN 137 137 137 GLN GLN A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 THR 142 142 142 THR THR A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 GLN 148 148 148 GLN GLN A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 THR 151 151 151 THR THR A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 PHE 154 154 154 PHE PHE A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 SER 156 156 156 SER SER A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 PHE 158 158 158 PHE PHE A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 ARG 160 160 160 ARG ARG A . n A 1 161 TRP 161 161 161 TRP TRP A . n A 1 162 ILE 162 162 162 ILE ILE A . n A 1 163 ASP 163 163 163 ASP ASP A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 GLU 165 165 165 GLU GLU A . n A 1 166 GLY 166 166 166 GLY GLY A . n A 1 167 HIS 167 167 167 HIS HIS A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 ASP 169 169 169 ASP ASP A . n A 1 170 PHE 170 170 170 PHE PHE A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 SER 172 172 172 SER SER A . n A 1 173 CYS 173 173 173 CYS CYS A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 ASP 175 175 175 ASP ASP A . n A 1 176 THR 176 176 176 THR THR A . n A 1 177 VAL 177 177 177 VAL VAL A . n A 1 178 THR 178 178 178 THR THR A . n A 1 179 ASP 179 179 179 ASP ASP A . n A 1 180 ARG 180 180 180 ARG ARG A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 ARG 182 182 182 ARG ARG A . n A 1 183 ALA 183 183 183 ALA ALA A . n A 1 184 VAL 184 184 184 VAL VAL A . n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 THR 186 186 186 THR THR A . n A 1 187 GLY 187 187 187 GLY GLY A . n A 1 188 LEU 188 188 ? ? ? A . n A 1 189 GLU 189 189 ? ? ? A . n A 1 190 HIS 190 190 ? ? ? A . n A 1 191 HIS 191 191 ? ? ? A . n A 1 192 HIS 192 192 ? ? ? A . n A 1 193 HIS 193 193 ? ? ? A . n A 1 194 HIS 194 194 ? ? ? A . n A 1 195 HIS 195 195 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 196 1 HOH HOH A . B 2 HOH 2 197 2 HOH HOH A . B 2 HOH 3 198 3 HOH HOH A . B 2 HOH 4 199 4 HOH HOH A . B 2 HOH 5 200 5 HOH HOH A . B 2 HOH 6 201 6 HOH HOH A . B 2 HOH 7 202 7 HOH HOH A . B 2 HOH 8 203 8 HOH HOH A . B 2 HOH 9 204 9 HOH HOH A . B 2 HOH 10 205 10 HOH HOH A . B 2 HOH 11 206 11 HOH HOH A . B 2 HOH 12 207 12 HOH HOH A . B 2 HOH 13 208 13 HOH HOH A . B 2 HOH 14 209 14 HOH HOH A . B 2 HOH 15 210 15 HOH HOH A . B 2 HOH 16 211 16 HOH HOH A . B 2 HOH 17 212 17 HOH HOH A . B 2 HOH 18 213 18 HOH HOH A . B 2 HOH 19 214 19 HOH HOH A . B 2 HOH 20 215 20 HOH HOH A . B 2 HOH 21 216 21 HOH HOH A . B 2 HOH 22 217 22 HOH HOH A . B 2 HOH 23 218 23 HOH HOH A . B 2 HOH 24 219 24 HOH HOH A . B 2 HOH 25 220 25 HOH HOH A . B 2 HOH 26 221 26 HOH HOH A . B 2 HOH 27 222 27 HOH HOH A . B 2 HOH 28 223 28 HOH HOH A . B 2 HOH 29 224 29 HOH HOH A . B 2 HOH 30 225 30 HOH HOH A . B 2 HOH 31 226 31 HOH HOH A . B 2 HOH 32 227 32 HOH HOH A . B 2 HOH 33 228 33 HOH HOH A . B 2 HOH 34 229 34 HOH HOH A . B 2 HOH 35 230 35 HOH HOH A . B 2 HOH 36 231 36 HOH HOH A . B 2 HOH 37 232 37 HOH HOH A . B 2 HOH 38 233 38 HOH HOH A . B 2 HOH 39 234 39 HOH HOH A . B 2 HOH 40 235 40 HOH HOH A . B 2 HOH 41 236 41 HOH HOH A . B 2 HOH 42 237 42 HOH HOH A . B 2 HOH 43 238 43 HOH HOH A . B 2 HOH 44 239 44 HOH HOH A . B 2 HOH 45 240 45 HOH HOH A . B 2 HOH 46 241 46 HOH HOH A . B 2 HOH 47 242 47 HOH HOH A . B 2 HOH 48 243 48 HOH HOH A . B 2 HOH 49 244 49 HOH HOH A . B 2 HOH 50 245 50 HOH HOH A . B 2 HOH 51 246 51 HOH HOH A . B 2 HOH 52 247 52 HOH HOH A . B 2 HOH 53 248 53 HOH HOH A . B 2 HOH 54 249 54 HOH HOH A . B 2 HOH 55 250 55 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 87 A MSE 87 ? MET SELENOMETHIONINE # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 software_defined_assembly PQS monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1,2 A,B 2 1 A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2440 ? 1 MORE -17 ? 1 'SSA (A^2)' 18480 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 102.9520000000 0.0000000000 -1.0000000000 0.0000000000 42.8640000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-03-13 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Source and taxonomy' 4 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 HKL-2000 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 SOLVE phasing . ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 5 ? ? -163.90 73.80 2 1 GLU A 22 ? ? -56.13 -81.25 3 1 HIS A 23 ? ? -74.20 -146.17 4 1 PRO A 75 ? ? -59.48 -6.13 5 1 VAL A 95 ? ? -80.19 39.56 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 188 ? A LEU 188 2 1 Y 1 A GLU 189 ? A GLU 189 3 1 Y 1 A HIS 190 ? A HIS 190 4 1 Y 1 A HIS 191 ? A HIS 191 5 1 Y 1 A HIS 192 ? A HIS 192 6 1 Y 1 A HIS 193 ? A HIS 193 7 1 Y 1 A HIS 194 ? A HIS 194 8 1 Y 1 A HIS 195 ? A HIS 195 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #