data_2DGW # _entry.id 2DGW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DGW pdb_00002dgw 10.2210/pdb2dgw/pdb RCSB RCSB025404 ? ? WWPDB D_1000025404 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-09-16 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DGW _pdbx_database_status.recvd_initial_deposition_date 2006-03-16 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk002100665.2 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Abe, C.' 1 'Muto, Y.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Terada, T.' 5 'Shirouzu, M.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of the second RNA recognition motif in RNA-binding protein 19' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Abe, C.' 1 ? primary 'Muto, Y.' 2 ? primary 'Inoue, M.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Terada, T.' 5 ? primary 'Shirouzu, M.' 6 ? primary 'Yokoyama, S.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Probable RNA-binding protein 19' _entity.formula_weight 10011.358 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'RNA recognition motif' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RNA-binding motif protein 19' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGTTCHTVKLRGAPFNVTEKNVMEFLAPLKPVAIRIVRNAHGNKTGYIFVDFSNEEEVKQALKCNREYMGGRYIE VFREKSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGTTCHTVKLRGAPFNVTEKNVMEFLAPLKPVAIRIVRNAHGNKTGYIFVDFSNEEEVKQALKCNREYMGGRYIE VFREKSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk002100665.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 THR n 1 9 THR n 1 10 CYS n 1 11 HIS n 1 12 THR n 1 13 VAL n 1 14 LYS n 1 15 LEU n 1 16 ARG n 1 17 GLY n 1 18 ALA n 1 19 PRO n 1 20 PHE n 1 21 ASN n 1 22 VAL n 1 23 THR n 1 24 GLU n 1 25 LYS n 1 26 ASN n 1 27 VAL n 1 28 MET n 1 29 GLU n 1 30 PHE n 1 31 LEU n 1 32 ALA n 1 33 PRO n 1 34 LEU n 1 35 LYS n 1 36 PRO n 1 37 VAL n 1 38 ALA n 1 39 ILE n 1 40 ARG n 1 41 ILE n 1 42 VAL n 1 43 ARG n 1 44 ASN n 1 45 ALA n 1 46 HIS n 1 47 GLY n 1 48 ASN n 1 49 LYS n 1 50 THR n 1 51 GLY n 1 52 TYR n 1 53 ILE n 1 54 PHE n 1 55 VAL n 1 56 ASP n 1 57 PHE n 1 58 SER n 1 59 ASN n 1 60 GLU n 1 61 GLU n 1 62 GLU n 1 63 VAL n 1 64 LYS n 1 65 GLN n 1 66 ALA n 1 67 LEU n 1 68 LYS n 1 69 CYS n 1 70 ASN n 1 71 ARG n 1 72 GLU n 1 73 TYR n 1 74 MET n 1 75 GLY n 1 76 GLY n 1 77 ARG n 1 78 TYR n 1 79 ILE n 1 80 GLU n 1 81 VAL n 1 82 PHE n 1 83 ARG n 1 84 GLU n 1 85 LYS n 1 86 SER n 1 87 GLY n 1 88 PRO n 1 89 SER n 1 90 SER n 1 91 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene RBM19 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cell free synthesis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P051121-04 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 284 284 GLY GLY A . n A 1 2 SER 2 285 285 SER SER A . n A 1 3 SER 3 286 286 SER SER A . n A 1 4 GLY 4 287 287 GLY GLY A . n A 1 5 SER 5 288 288 SER SER A . n A 1 6 SER 6 289 289 SER SER A . n A 1 7 GLY 7 290 290 GLY GLY A . n A 1 8 THR 8 291 291 THR THR A . n A 1 9 THR 9 292 292 THR THR A . n A 1 10 CYS 10 293 293 CYS CYS A . n A 1 11 HIS 11 294 294 HIS HIS A . n A 1 12 THR 12 295 295 THR THR A . n A 1 13 VAL 13 296 296 VAL VAL A . n A 1 14 LYS 14 297 297 LYS LYS A . n A 1 15 LEU 15 298 298 LEU LEU A . n A 1 16 ARG 16 299 299 ARG ARG A . n A 1 17 GLY 17 300 300 GLY GLY A . n A 1 18 ALA 18 301 301 ALA ALA A . n A 1 19 PRO 19 302 302 PRO PRO A . n A 1 20 PHE 20 303 303 PHE PHE A . n A 1 21 ASN 21 304 304 ASN ASN A . n A 1 22 VAL 22 305 305 VAL VAL A . n A 1 23 THR 23 306 306 THR THR A . n A 1 24 GLU 24 307 307 GLU GLU A . n A 1 25 LYS 25 308 308 LYS LYS A . n A 1 26 ASN 26 309 309 ASN ASN A . n A 1 27 VAL 27 310 310 VAL VAL A . n A 1 28 MET 28 311 311 MET MET A . n A 1 29 GLU 29 312 312 GLU GLU A . n A 1 30 PHE 30 313 313 PHE PHE A . n A 1 31 LEU 31 314 314 LEU LEU A . n A 1 32 ALA 32 315 315 ALA ALA A . n A 1 33 PRO 33 316 316 PRO PRO A . n A 1 34 LEU 34 317 317 LEU LEU A . n A 1 35 LYS 35 318 318 LYS LYS A . n A 1 36 PRO 36 319 319 PRO PRO A . n A 1 37 VAL 37 320 320 VAL VAL A . n A 1 38 ALA 38 321 321 ALA ALA A . n A 1 39 ILE 39 322 322 ILE ILE A . n A 1 40 ARG 40 323 323 ARG ARG A . n A 1 41 ILE 41 324 324 ILE ILE A . n A 1 42 VAL 42 325 325 VAL VAL A . n A 1 43 ARG 43 326 326 ARG ARG A . n A 1 44 ASN 44 327 327 ASN ASN A . n A 1 45 ALA 45 328 328 ALA ALA A . n A 1 46 HIS 46 329 329 HIS HIS A . n A 1 47 GLY 47 330 330 GLY GLY A . n A 1 48 ASN 48 331 331 ASN ASN A . n A 1 49 LYS 49 332 332 LYS LYS A . n A 1 50 THR 50 333 333 THR THR A . n A 1 51 GLY 51 334 334 GLY GLY A . n A 1 52 TYR 52 335 335 TYR TYR A . n A 1 53 ILE 53 336 336 ILE ILE A . n A 1 54 PHE 54 337 337 PHE PHE A . n A 1 55 VAL 55 338 338 VAL VAL A . n A 1 56 ASP 56 339 339 ASP ASP A . n A 1 57 PHE 57 340 340 PHE PHE A . n A 1 58 SER 58 341 341 SER SER A . n A 1 59 ASN 59 342 342 ASN ASN A . n A 1 60 GLU 60 343 343 GLU GLU A . n A 1 61 GLU 61 344 344 GLU GLU A . n A 1 62 GLU 62 345 345 GLU GLU A . n A 1 63 VAL 63 346 346 VAL VAL A . n A 1 64 LYS 64 347 347 LYS LYS A . n A 1 65 GLN 65 348 348 GLN GLN A . n A 1 66 ALA 66 349 349 ALA ALA A . n A 1 67 LEU 67 350 350 LEU LEU A . n A 1 68 LYS 68 351 351 LYS LYS A . n A 1 69 CYS 69 352 352 CYS CYS A . n A 1 70 ASN 70 353 353 ASN ASN A . n A 1 71 ARG 71 354 354 ARG ARG A . n A 1 72 GLU 72 355 355 GLU GLU A . n A 1 73 TYR 73 356 356 TYR TYR A . n A 1 74 MET 74 357 357 MET MET A . n A 1 75 GLY 75 358 358 GLY GLY A . n A 1 76 GLY 76 359 359 GLY GLY A . n A 1 77 ARG 77 360 360 ARG ARG A . n A 1 78 TYR 78 361 361 TYR TYR A . n A 1 79 ILE 79 362 362 ILE ILE A . n A 1 80 GLU 80 363 363 GLU GLU A . n A 1 81 VAL 81 364 364 VAL VAL A . n A 1 82 PHE 82 365 365 PHE PHE A . n A 1 83 ARG 83 366 366 ARG ARG A . n A 1 84 GLU 84 367 367 GLU GLU A . n A 1 85 LYS 85 368 368 LYS LYS A . n A 1 86 SER 86 369 369 SER SER A . n A 1 87 GLY 87 370 370 GLY GLY A . n A 1 88 PRO 88 371 371 PRO PRO A . n A 1 89 SER 89 372 372 SER SER A . n A 1 90 SER 90 373 373 SER SER A . n A 1 91 GLY 91 374 374 GLY GLY A . n # _exptl.entry_id 2DGW _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2DGW _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2DGW _struct.title 'Solution structure of the second RNA recognition motif in RNA-binding protein 19' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DGW _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.text ;RRM domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RBM19_HUMAN _struct_ref.pdbx_db_accession Q9Y4C8 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 291 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DGW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 85 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9Y4C8 _struct_ref_seq.db_align_beg 291 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 368 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 291 _struct_ref_seq.pdbx_auth_seq_align_end 368 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DGW GLY A 1 ? UNP Q9Y4C8 ? ? 'cloning artifact' 284 1 1 2DGW SER A 2 ? UNP Q9Y4C8 ? ? 'cloning artifact' 285 2 1 2DGW SER A 3 ? UNP Q9Y4C8 ? ? 'cloning artifact' 286 3 1 2DGW GLY A 4 ? UNP Q9Y4C8 ? ? 'cloning artifact' 287 4 1 2DGW SER A 5 ? UNP Q9Y4C8 ? ? 'cloning artifact' 288 5 1 2DGW SER A 6 ? UNP Q9Y4C8 ? ? 'cloning artifact' 289 6 1 2DGW GLY A 7 ? UNP Q9Y4C8 ? ? 'cloning artifact' 290 7 1 2DGW SER A 86 ? UNP Q9Y4C8 ? ? 'cloning artifact' 369 8 1 2DGW GLY A 87 ? UNP Q9Y4C8 ? ? 'cloning artifact' 370 9 1 2DGW PRO A 88 ? UNP Q9Y4C8 ? ? 'cloning artifact' 371 10 1 2DGW SER A 89 ? UNP Q9Y4C8 ? ? 'cloning artifact' 372 11 1 2DGW SER A 90 ? UNP Q9Y4C8 ? ? 'cloning artifact' 373 12 1 2DGW GLY A 91 ? UNP Q9Y4C8 ? ? 'cloning artifact' 374 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 23 ? ALA A 32 ? THR A 306 ALA A 315 1 ? 10 HELX_P HELX_P2 2 ASN A 59 ? CYS A 69 ? ASN A 342 CYS A 352 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ALA 32 A . ? ALA 315 A PRO 33 A ? PRO 316 A 1 -0.04 2 ALA 32 A . ? ALA 315 A PRO 33 A ? PRO 316 A 2 0.00 3 ALA 32 A . ? ALA 315 A PRO 33 A ? PRO 316 A 3 0.03 4 ALA 32 A . ? ALA 315 A PRO 33 A ? PRO 316 A 4 -0.03 5 ALA 32 A . ? ALA 315 A PRO 33 A ? PRO 316 A 5 -0.04 6 ALA 32 A . ? ALA 315 A PRO 33 A ? PRO 316 A 6 -0.02 7 ALA 32 A . ? ALA 315 A PRO 33 A ? PRO 316 A 7 -0.01 8 ALA 32 A . ? ALA 315 A PRO 33 A ? PRO 316 A 8 -0.04 9 ALA 32 A . ? ALA 315 A PRO 33 A ? PRO 316 A 9 0.04 10 ALA 32 A . ? ALA 315 A PRO 33 A ? PRO 316 A 10 0.07 11 ALA 32 A . ? ALA 315 A PRO 33 A ? PRO 316 A 11 -0.03 12 ALA 32 A . ? ALA 315 A PRO 33 A ? PRO 316 A 12 0.07 13 ALA 32 A . ? ALA 315 A PRO 33 A ? PRO 316 A 13 0.05 14 ALA 32 A . ? ALA 315 A PRO 33 A ? PRO 316 A 14 0.03 15 ALA 32 A . ? ALA 315 A PRO 33 A ? PRO 316 A 15 -0.03 16 ALA 32 A . ? ALA 315 A PRO 33 A ? PRO 316 A 16 -0.03 17 ALA 32 A . ? ALA 315 A PRO 33 A ? PRO 316 A 17 -0.03 18 ALA 32 A . ? ALA 315 A PRO 33 A ? PRO 316 A 18 0.05 19 ALA 32 A . ? ALA 315 A PRO 33 A ? PRO 316 A 19 0.01 20 ALA 32 A . ? ALA 315 A PRO 33 A ? PRO 316 A 20 0.08 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 38 ? ARG A 43 ? ALA A 321 ARG A 326 A 2 LYS A 49 ? ASP A 56 ? LYS A 332 ASP A 339 A 3 THR A 12 ? ARG A 16 ? THR A 295 ARG A 299 A 4 ARG A 77 ? GLU A 84 ? ARG A 360 GLU A 367 A 5 GLU A 72 ? MET A 74 ? GLU A 355 MET A 357 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 40 ? N ARG A 323 O PHE A 54 ? O PHE A 337 A 2 3 O VAL A 55 ? O VAL A 338 N VAL A 13 ? N VAL A 296 A 3 4 N LYS A 14 ? N LYS A 297 O PHE A 82 ? O PHE A 365 A 4 5 O ILE A 79 ? O ILE A 362 N GLU A 72 ? N GLU A 355 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 291 ? ? -34.47 125.06 2 1 HIS A 294 ? ? -38.85 132.00 3 1 PRO A 302 ? ? -69.75 -165.90 4 1 ALA A 315 ? ? -46.37 166.56 5 1 PRO A 319 ? ? -69.77 -179.07 6 1 ASN A 327 ? ? -47.20 173.43 7 1 HIS A 329 ? ? -86.06 38.14 8 1 TYR A 335 ? ? -170.07 121.95 9 1 CYS A 352 ? ? -69.06 72.23 10 1 SER A 372 ? ? -130.15 -48.80 11 2 SER A 288 ? ? -95.45 39.09 12 2 ASN A 304 ? ? -99.24 35.75 13 2 PRO A 319 ? ? -69.73 -177.61 14 2 VAL A 325 ? ? -59.39 103.58 15 2 HIS A 329 ? ? 35.09 50.23 16 2 CYS A 352 ? ? -64.59 83.19 17 2 PRO A 371 ? ? -69.82 1.82 18 3 THR A 291 ? ? -46.60 167.07 19 3 ALA A 315 ? ? -44.40 166.25 20 3 LEU A 317 ? ? -50.03 170.80 21 3 PRO A 319 ? ? -69.79 -175.94 22 3 VAL A 325 ? ? -47.54 100.53 23 3 ASN A 327 ? ? -52.42 178.52 24 3 ASN A 331 ? ? -172.97 120.32 25 3 LYS A 332 ? ? -54.38 98.04 26 3 TYR A 335 ? ? -34.54 148.32 27 3 GLU A 367 ? ? -112.54 79.26 28 3 PRO A 371 ? ? -69.78 -178.84 29 3 SER A 373 ? ? -36.12 145.49 30 4 SER A 286 ? ? 39.84 38.93 31 4 PRO A 302 ? ? -69.77 -176.40 32 4 ASN A 304 ? ? -92.81 43.76 33 4 PRO A 319 ? ? -69.78 -163.83 34 4 ALA A 328 ? ? -41.07 -70.61 35 4 CYS A 352 ? ? -69.11 72.68 36 4 GLU A 367 ? ? -64.02 81.88 37 5 PRO A 302 ? ? -69.71 -173.14 38 5 ASN A 304 ? ? -95.34 44.44 39 5 ALA A 315 ? ? -45.54 161.54 40 5 PRO A 319 ? ? -69.77 -175.39 41 5 LYS A 332 ? ? -59.70 105.54 42 6 SER A 285 ? ? 34.96 43.28 43 6 SER A 286 ? ? -88.35 42.27 44 6 ASN A 304 ? ? -98.71 47.78 45 6 PRO A 319 ? ? -69.78 -171.94 46 6 VAL A 325 ? ? -35.38 145.14 47 6 ARG A 326 ? ? -34.37 108.70 48 6 LYS A 332 ? ? -38.17 126.14 49 6 ARG A 354 ? ? 73.18 35.82 50 6 PRO A 371 ? ? -69.75 86.23 51 7 SER A 288 ? ? -51.49 173.72 52 7 HIS A 294 ? ? -38.81 121.65 53 7 PRO A 302 ? ? -69.80 -172.79 54 7 ASN A 304 ? ? -87.42 39.98 55 7 LEU A 317 ? ? -48.09 165.72 56 7 PRO A 319 ? ? -69.75 -168.64 57 7 ASN A 327 ? ? -44.90 165.68 58 7 PRO A 371 ? ? -69.76 2.61 59 7 SER A 372 ? ? -38.38 -39.06 60 8 ASN A 304 ? ? -90.44 48.51 61 8 ALA A 315 ? ? -48.49 162.89 62 8 LEU A 317 ? ? -39.48 157.97 63 8 PRO A 319 ? ? -69.76 -175.67 64 8 VAL A 325 ? ? -49.56 106.46 65 8 CYS A 352 ? ? -65.71 74.05 66 8 SER A 372 ? ? -38.86 154.94 67 9 THR A 291 ? ? -44.14 164.18 68 9 THR A 292 ? ? -57.38 98.66 69 9 ASN A 304 ? ? -85.40 46.28 70 9 ALA A 315 ? ? -49.86 162.62 71 9 LEU A 317 ? ? -46.70 156.69 72 9 PRO A 319 ? ? -69.76 -174.65 73 9 ASN A 331 ? ? -170.68 112.68 74 9 TYR A 361 ? ? -47.01 165.93 75 9 PRO A 371 ? ? -69.80 88.83 76 10 SER A 285 ? ? 35.32 41.38 77 10 SER A 286 ? ? 39.80 50.74 78 10 ASN A 304 ? ? -92.86 46.38 79 10 ALA A 315 ? ? -41.31 161.06 80 10 PRO A 319 ? ? -69.76 -169.96 81 10 HIS A 329 ? ? -84.78 49.01 82 10 THR A 333 ? ? -103.53 79.56 83 10 TYR A 335 ? ? -168.82 117.96 84 10 ARG A 354 ? ? 31.44 38.25 85 11 SER A 286 ? ? -88.51 42.11 86 11 PRO A 302 ? ? -69.76 -170.08 87 11 GLU A 307 ? ? -38.10 -32.61 88 11 PRO A 319 ? ? -69.79 -175.76 89 11 VAL A 325 ? ? -57.67 92.23 90 11 ASN A 327 ? ? -51.36 -70.43 91 11 HIS A 329 ? ? 43.68 29.24 92 11 THR A 333 ? ? -113.71 69.28 93 11 CYS A 352 ? ? -62.05 85.04 94 11 ARG A 354 ? ? 30.59 44.59 95 11 SER A 369 ? ? 38.28 40.43 96 12 SER A 288 ? ? -90.00 43.45 97 12 SER A 289 ? ? -39.80 133.83 98 12 THR A 291 ? ? 35.06 45.02 99 12 ASN A 304 ? ? -85.00 34.41 100 12 GLU A 307 ? ? -34.46 -38.48 101 12 ALA A 315 ? ? -49.73 164.52 102 12 PRO A 319 ? ? -69.75 -176.62 103 12 HIS A 329 ? ? -121.51 -67.37 104 12 THR A 333 ? ? -173.11 148.09 105 12 CYS A 352 ? ? -95.93 52.17 106 12 SER A 369 ? ? 36.79 54.50 107 12 PRO A 371 ? ? -69.79 0.74 108 12 SER A 372 ? ? 74.34 54.03 109 13 SER A 288 ? ? -63.32 90.09 110 13 PRO A 302 ? ? -69.75 -165.97 111 13 ALA A 315 ? ? -48.40 161.95 112 13 PRO A 319 ? ? -69.74 -175.54 113 13 ARG A 326 ? ? -99.39 37.95 114 14 PRO A 302 ? ? -69.76 -178.51 115 14 ALA A 315 ? ? -46.22 163.33 116 14 PRO A 319 ? ? -69.76 -169.90 117 14 ASN A 331 ? ? -34.77 132.38 118 14 LYS A 332 ? ? -66.80 83.83 119 14 CYS A 352 ? ? -69.76 69.42 120 14 GLU A 367 ? ? -104.19 46.79 121 15 ASN A 304 ? ? -93.58 36.72 122 15 LEU A 317 ? ? -38.33 125.34 123 15 PRO A 319 ? ? -69.81 -172.07 124 15 ALA A 328 ? ? -131.79 -69.23 125 15 ASN A 331 ? ? -105.92 79.71 126 15 TYR A 335 ? ? -167.39 112.88 127 16 THR A 292 ? ? 39.63 47.01 128 16 PRO A 302 ? ? -69.73 -172.45 129 16 ALA A 315 ? ? -44.06 159.32 130 16 LEU A 317 ? ? -46.72 161.15 131 16 PRO A 319 ? ? -69.71 -173.60 132 16 ASN A 327 ? ? -133.04 -64.94 133 16 HIS A 329 ? ? -111.35 -72.47 134 16 LYS A 332 ? ? -59.93 105.17 135 16 THR A 333 ? ? -173.47 132.15 136 16 CYS A 352 ? ? -69.36 85.19 137 16 ARG A 354 ? ? 32.44 38.78 138 16 SER A 373 ? ? -84.23 42.00 139 17 SER A 285 ? ? 34.89 51.16 140 17 PRO A 302 ? ? -69.76 -171.95 141 17 ALA A 315 ? ? -48.68 163.87 142 17 PRO A 319 ? ? -69.72 -164.54 143 17 VAL A 325 ? ? -52.64 107.68 144 17 THR A 333 ? ? -118.69 72.52 145 17 ARG A 354 ? ? 35.42 42.86 146 18 SER A 285 ? ? 38.34 42.15 147 18 THR A 292 ? ? -35.49 128.26 148 18 PRO A 302 ? ? -69.78 -176.54 149 18 ASN A 304 ? ? -88.59 48.46 150 18 ALA A 315 ? ? -47.09 159.96 151 18 PRO A 319 ? ? -69.71 -178.33 152 18 THR A 333 ? ? -39.43 145.23 153 18 GLU A 345 ? ? -39.74 -36.15 154 18 GLU A 367 ? ? -101.61 74.37 155 19 PRO A 302 ? ? -69.79 -167.74 156 19 ALA A 328 ? ? -99.64 -73.57 157 19 HIS A 329 ? ? -124.28 -71.42 158 19 ARG A 354 ? ? 70.15 30.44 159 20 SER A 285 ? ? -131.65 -51.54 160 20 SER A 286 ? ? 34.52 42.32 161 20 ASN A 304 ? ? -86.89 35.44 162 20 ALA A 315 ? ? -44.58 156.74 163 20 LEU A 317 ? ? -39.01 138.40 164 20 PRO A 319 ? ? -69.78 -171.02 165 20 VAL A 325 ? ? -64.56 80.83 166 20 ASN A 327 ? ? -57.04 -179.31 167 20 TYR A 335 ? ? -34.24 140.29 168 20 ARG A 354 ? ? 37.29 49.88 169 20 PRO A 371 ? ? -69.69 95.00 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 2DGW _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DGW _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '20mM d-Tris-HCl(pH7.0), 100mM NaCl, 1mM d-DTT, 0.02% NaN3, 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_refine.entry_id 2DGW _pdbx_nmr_refine.method 'torsion angle dynamics, restrainted molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.932 'Kobayashi, N.' 4 'structure solution' CYANA 2.0 'Guntert, P.' 5 refinement CYANA 2.0 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2DGW _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_