data_2DIC # _entry.id 2DIC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DIC pdb_00002dic 10.2210/pdb2dic/pdb RCSB RCSB025448 ? ? WWPDB D_1000025448 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk003002600.5 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DIC _pdbx_database_status.recvd_initial_deposition_date 2006-03-29 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tomizawa, T.' 1 'Koshiba, S.' 2 'Watanabe, S.' 3 'Harada, T.' 4 'Kigawa, T.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution structure of the 12th filamin domain from human Filamin-B' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tomizawa, T.' 1 ? primary 'Koshiba, S.' 2 ? primary 'Watanabe, S.' 3 ? primary 'Harada, T.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Yokoyama, S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Filamin-B _entity.formula_weight 10707.804 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Filamin domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;FLN-B, Beta-filamin, Actin-binding-like protein, Thyroid autoantigen, Truncated actin-binding protein, Truncated ABP, ABP-280 homolog, ABP-278, Filamin 3, Filamin homolog 1, Fh1 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKDGSCSAEYIPFAPGDYDV NITYGGAHIPGSPFRVPVKDVVDPS ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKDGSCSAEYIPFAPGDYDV NITYGGAHIPGSPFRVPVKDVVDPS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk003002600.5 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLY n 1 9 CYS n 1 10 GLN n 1 11 PRO n 1 12 SER n 1 13 ARG n 1 14 VAL n 1 15 GLN n 1 16 ALA n 1 17 GLN n 1 18 GLY n 1 19 PRO n 1 20 GLY n 1 21 LEU n 1 22 LYS n 1 23 GLU n 1 24 ALA n 1 25 PHE n 1 26 THR n 1 27 ASN n 1 28 LYS n 1 29 PRO n 1 30 ASN n 1 31 VAL n 1 32 PHE n 1 33 THR n 1 34 VAL n 1 35 VAL n 1 36 THR n 1 37 ARG n 1 38 GLY n 1 39 ALA n 1 40 GLY n 1 41 ILE n 1 42 GLY n 1 43 GLY n 1 44 LEU n 1 45 GLY n 1 46 ILE n 1 47 THR n 1 48 VAL n 1 49 GLU n 1 50 GLY n 1 51 PRO n 1 52 SER n 1 53 GLU n 1 54 SER n 1 55 LYS n 1 56 ILE n 1 57 ASN n 1 58 CYS n 1 59 ARG n 1 60 ASP n 1 61 ASN n 1 62 LYS n 1 63 ASP n 1 64 GLY n 1 65 SER n 1 66 CYS n 1 67 SER n 1 68 ALA n 1 69 GLU n 1 70 TYR n 1 71 ILE n 1 72 PRO n 1 73 PHE n 1 74 ALA n 1 75 PRO n 1 76 GLY n 1 77 ASP n 1 78 TYR n 1 79 ASP n 1 80 VAL n 1 81 ASN n 1 82 ILE n 1 83 THR n 1 84 TYR n 1 85 GLY n 1 86 GLY n 1 87 ALA n 1 88 HIS n 1 89 ILE n 1 90 PRO n 1 91 GLY n 1 92 SER n 1 93 PRO n 1 94 PHE n 1 95 ARG n 1 96 VAL n 1 97 PRO n 1 98 VAL n 1 99 LYS n 1 100 ASP n 1 101 VAL n 1 102 VAL n 1 103 ASP n 1 104 PRO n 1 105 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene FLNB _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cell free synthesis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060123-12 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FLNB_HUMAN _struct_ref.pdbx_db_accession O75369 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 1325 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DIC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 105 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O75369 _struct_ref_seq.db_align_beg 1325 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1422 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 105 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DIC GLY A 1 ? UNP O75369 ? ? 'cloning artifact' 1 1 1 2DIC SER A 2 ? UNP O75369 ? ? 'cloning artifact' 2 2 1 2DIC SER A 3 ? UNP O75369 ? ? 'cloning artifact' 3 3 1 2DIC GLY A 4 ? UNP O75369 ? ? 'cloning artifact' 4 4 1 2DIC SER A 5 ? UNP O75369 ? ? 'cloning artifact' 5 5 1 2DIC SER A 6 ? UNP O75369 ? ? 'cloning artifact' 6 6 1 2DIC GLY A 7 ? UNP O75369 ? ? 'cloning artifact' 7 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.18mM Filamin domain U-15N,13C; 20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2DIC _pdbx_nmr_refine.method 'torsion angle dynamics, restrainted molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2DIC _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DIC _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9742 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2DIC _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2DIC _struct.title 'Solution structure of the 12th filamin domain from human Filamin-B' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DIC _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' _struct_keywords.text ;beta-sandwich, immunoglobulin-like fold, filamin domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural protein ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id GLY _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 18 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 23 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLY _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 18 _struct_conf.end_auth_comp_id GLU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 23 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 SER 92 A . ? SER 92 A PRO 93 A ? PRO 93 A 1 -0.05 2 SER 92 A . ? SER 92 A PRO 93 A ? PRO 93 A 2 -0.09 3 SER 92 A . ? SER 92 A PRO 93 A ? PRO 93 A 3 -0.08 4 SER 92 A . ? SER 92 A PRO 93 A ? PRO 93 A 4 -0.01 5 SER 92 A . ? SER 92 A PRO 93 A ? PRO 93 A 5 -0.01 6 SER 92 A . ? SER 92 A PRO 93 A ? PRO 93 A 6 -0.05 7 SER 92 A . ? SER 92 A PRO 93 A ? PRO 93 A 7 0.02 8 SER 92 A . ? SER 92 A PRO 93 A ? PRO 93 A 8 -0.03 9 SER 92 A . ? SER 92 A PRO 93 A ? PRO 93 A 9 -0.07 10 SER 92 A . ? SER 92 A PRO 93 A ? PRO 93 A 10 -0.02 11 SER 92 A . ? SER 92 A PRO 93 A ? PRO 93 A 11 -0.02 12 SER 92 A . ? SER 92 A PRO 93 A ? PRO 93 A 12 0.01 13 SER 92 A . ? SER 92 A PRO 93 A ? PRO 93 A 13 0.00 14 SER 92 A . ? SER 92 A PRO 93 A ? PRO 93 A 14 -0.01 15 SER 92 A . ? SER 92 A PRO 93 A ? PRO 93 A 15 -0.04 16 SER 92 A . ? SER 92 A PRO 93 A ? PRO 93 A 16 0.01 17 SER 92 A . ? SER 92 A PRO 93 A ? PRO 93 A 17 -0.07 18 SER 92 A . ? SER 92 A PRO 93 A ? PRO 93 A 18 -0.02 19 SER 92 A . ? SER 92 A PRO 93 A ? PRO 93 A 19 0.01 20 SER 92 A . ? SER 92 A PRO 93 A ? PRO 93 A 20 0.01 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 4 ? C ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel C 1 2 ? parallel C 2 3 ? anti-parallel C 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 15 ? GLN A 17 ? GLN A 15 GLN A 17 A 2 ASN A 30 ? VAL A 35 ? ASN A 30 VAL A 35 A 3 CYS A 66 ? TYR A 70 ? CYS A 66 TYR A 70 A 4 ASN A 57 ? ASP A 60 ? ASN A 57 ASP A 60 B 1 ALA A 24 ? PHE A 25 ? ALA A 24 PHE A 25 B 2 PHE A 94 ? LYS A 99 ? PHE A 94 LYS A 99 B 3 GLY A 76 ? TYR A 84 ? GLY A 76 TYR A 84 B 4 LEU A 44 ? GLU A 49 ? LEU A 44 GLU A 49 C 1 ALA A 24 ? PHE A 25 ? ALA A 24 PHE A 25 C 2 PHE A 94 ? LYS A 99 ? PHE A 94 LYS A 99 C 3 GLY A 76 ? TYR A 84 ? GLY A 76 TYR A 84 C 4 ALA A 87 ? HIS A 88 ? ALA A 87 HIS A 88 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLN A 17 ? N GLN A 17 O THR A 33 ? O THR A 33 A 2 3 N ASN A 30 ? N ASN A 30 O TYR A 70 ? O TYR A 70 A 3 4 O GLU A 69 ? O GLU A 69 N ASN A 57 ? N ASN A 57 B 1 2 N ALA A 24 ? N ALA A 24 O LYS A 99 ? O LYS A 99 B 2 3 O VAL A 98 ? O VAL A 98 N GLY A 76 ? N GLY A 76 B 3 4 O ASN A 81 ? O ASN A 81 N THR A 47 ? N THR A 47 C 1 2 N ALA A 24 ? N ALA A 24 O LYS A 99 ? O LYS A 99 C 2 3 O VAL A 98 ? O VAL A 98 N GLY A 76 ? N GLY A 76 C 3 4 N TYR A 84 ? N TYR A 84 O ALA A 87 ? O ALA A 87 # _database_PDB_matrix.entry_id 2DIC _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DIC _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 CYS 58 58 58 CYS CYS A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 PRO 104 104 104 PRO PRO A . n A 1 105 SER 105 105 105 SER SER A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-09-29 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 51 ? ? -69.76 2.78 2 1 LYS A 62 ? ? -92.21 42.85 3 1 ASP A 63 ? ? -131.97 -57.04 4 1 PRO A 90 ? ? -69.80 93.39 5 2 LYS A 62 ? ? -85.60 33.03 6 2 ASP A 63 ? ? -120.43 -51.67 7 2 SER A 65 ? ? -171.90 -178.75 8 2 PRO A 90 ? ? -69.76 89.70 9 3 SER A 2 ? ? -42.54 153.85 10 3 CYS A 9 ? ? -35.35 135.78 11 3 PRO A 51 ? ? -69.77 0.98 12 3 LYS A 62 ? ? -89.76 39.06 13 3 ASP A 63 ? ? -127.09 -58.80 14 3 PRO A 90 ? ? -69.77 81.39 15 4 SER A 3 ? ? -100.66 42.48 16 4 SER A 5 ? ? -174.35 146.37 17 4 LYS A 62 ? ? -87.57 42.31 18 4 ASP A 63 ? ? -132.73 -53.17 19 4 PRO A 90 ? ? -69.82 93.90 20 4 VAL A 102 ? ? -173.51 137.27 21 5 SER A 2 ? ? -105.90 -60.89 22 5 LYS A 62 ? ? -85.09 48.21 23 5 ASP A 63 ? ? -132.34 -56.85 24 5 PRO A 90 ? ? -69.77 92.34 25 6 SER A 2 ? ? -60.38 94.07 26 6 ALA A 39 ? ? -87.91 31.32 27 6 LYS A 62 ? ? -82.65 44.79 28 6 PRO A 90 ? ? -69.79 98.33 29 6 PRO A 97 ? ? -69.70 97.90 30 7 SER A 2 ? ? -58.99 107.62 31 7 THR A 36 ? ? -99.46 47.02 32 7 PRO A 51 ? ? -69.69 0.41 33 7 LYS A 62 ? ? -86.50 31.54 34 7 PRO A 90 ? ? -69.74 90.79 35 8 THR A 36 ? ? -98.80 35.58 36 8 LYS A 62 ? ? -87.86 37.83 37 8 ASP A 63 ? ? -122.21 -61.00 38 8 PRO A 90 ? ? -69.77 92.96 39 8 PRO A 97 ? ? -69.80 90.32 40 9 LYS A 22 ? ? -92.57 -64.74 41 9 ARG A 37 ? ? -59.57 -74.19 42 9 ILE A 41 ? ? -69.78 96.62 43 9 PRO A 51 ? ? -69.72 0.01 44 9 LYS A 62 ? ? -89.04 41.13 45 9 ASP A 63 ? ? -121.43 -54.59 46 9 PRO A 90 ? ? -69.72 85.95 47 10 LYS A 62 ? ? -87.12 40.09 48 10 SER A 65 ? ? -171.95 -178.18 49 10 PRO A 90 ? ? -69.75 93.85 50 10 PRO A 97 ? ? -69.73 99.19 51 11 LYS A 62 ? ? -85.34 46.04 52 11 SER A 65 ? ? -175.03 -175.32 53 11 PRO A 90 ? ? -69.84 85.92 54 12 SER A 3 ? ? -90.04 41.46 55 12 ILE A 41 ? ? -113.67 78.16 56 12 SER A 65 ? ? -170.45 -176.13 57 12 PRO A 90 ? ? -69.72 94.40 58 12 PRO A 104 ? ? -69.74 -177.56 59 13 LYS A 62 ? ? -89.01 37.25 60 13 PRO A 90 ? ? -69.77 88.61 61 14 PRO A 51 ? ? -69.71 2.59 62 14 PRO A 90 ? ? -69.69 97.62 63 15 SER A 2 ? ? -39.04 127.81 64 15 SER A 6 ? ? -59.60 176.74 65 15 LYS A 62 ? ? -89.65 47.59 66 15 ASP A 63 ? ? -124.48 -56.09 67 15 PRO A 90 ? ? -69.82 95.51 68 15 PRO A 97 ? ? -69.81 98.99 69 16 LYS A 62 ? ? -84.17 40.80 70 16 PRO A 90 ? ? -69.82 85.98 71 16 PRO A 97 ? ? -69.75 93.76 72 16 PRO A 104 ? ? -69.80 99.44 73 17 ARG A 37 ? ? -51.40 87.09 74 17 PRO A 51 ? ? -69.71 2.29 75 17 LYS A 62 ? ? -88.75 44.35 76 17 ASP A 63 ? ? -134.90 -62.77 77 17 PRO A 90 ? ? -69.73 88.93 78 17 VAL A 102 ? ? -33.89 123.09 79 18 ALA A 39 ? ? -103.31 -62.28 80 18 LYS A 62 ? ? -86.26 34.70 81 18 PRO A 90 ? ? -69.79 89.53 82 19 SER A 6 ? ? 39.77 39.31 83 19 LYS A 62 ? ? -85.02 36.27 84 19 PRO A 90 ? ? -69.73 95.83 85 20 LYS A 62 ? ? -108.70 40.87 86 20 ASP A 63 ? ? -122.58 -70.13 87 20 PRO A 90 ? ? -69.77 93.44 88 20 PRO A 97 ? ? -69.78 99.57 #