data_2DIN # _entry.id 2DIN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DIN pdb_00002din 10.2210/pdb2din/pdb RCSB RCSB025456 ? ? WWPDB D_1000025456 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2DIM _pdbx_database_related.details 'The different fragment of the same protein' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DIN _pdbx_database_status.recvd_initial_deposition_date 2006-03-30 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yoneyama, M.' 1 'Tochio, N.' 2 'Koshiba, S.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution structure of the Myb_DNA-binding domain of human Cell division cycle 5-like protein' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yoneyama, M.' 1 ? primary 'Tochio, N.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Yokoyama, S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Cell division cycle 5-like protein' _entity.formula_weight 7297.183 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Myb_DNA-binding domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cdc5-like protein, Pombe cdc5-related protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGKKTEWSREEEEKLLHLAKLMPTQWRTIAPIIGRTAAQCLEHYEFLLDKAAQRDSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGKKTEWSREEEEKLLHLAKLMPTQWRTIAPIIGRTAAQCLEHYEFLLDKAAQRDSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 LYS n 1 9 LYS n 1 10 THR n 1 11 GLU n 1 12 TRP n 1 13 SER n 1 14 ARG n 1 15 GLU n 1 16 GLU n 1 17 GLU n 1 18 GLU n 1 19 LYS n 1 20 LEU n 1 21 LEU n 1 22 HIS n 1 23 LEU n 1 24 ALA n 1 25 LYS n 1 26 LEU n 1 27 MET n 1 28 PRO n 1 29 THR n 1 30 GLN n 1 31 TRP n 1 32 ARG n 1 33 THR n 1 34 ILE n 1 35 ALA n 1 36 PRO n 1 37 ILE n 1 38 ILE n 1 39 GLY n 1 40 ARG n 1 41 THR n 1 42 ALA n 1 43 ALA n 1 44 GLN n 1 45 CYS n 1 46 LEU n 1 47 GLU n 1 48 HIS n 1 49 TYR n 1 50 GLU n 1 51 PHE n 1 52 LEU n 1 53 LEU n 1 54 ASP n 1 55 LYS n 1 56 ALA n 1 57 ALA n 1 58 GLN n 1 59 ARG n 1 60 ASP n 1 61 SER n 1 62 GLY n 1 63 PRO n 1 64 SER n 1 65 SER n 1 66 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene CDC5L _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050905-03 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CDC5L_HUMAN _struct_ref.pdbx_db_accession Q99459 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KKTEWSREEEEKLLHLAKLMPTQWRTIAPIIGRTAAQCLEHYEFLLDKAAQRD _struct_ref.pdbx_align_begin 59 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DIN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 60 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q99459 _struct_ref_seq.db_align_beg 59 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 111 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 60 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DIN GLY A 1 ? UNP Q99459 ? ? 'cloning artifact' 1 1 1 2DIN SER A 2 ? UNP Q99459 ? ? 'cloning artifact' 2 2 1 2DIN SER A 3 ? UNP Q99459 ? ? 'cloning artifact' 3 3 1 2DIN GLY A 4 ? UNP Q99459 ? ? 'cloning artifact' 4 4 1 2DIN SER A 5 ? UNP Q99459 ? ? 'cloning artifact' 5 5 1 2DIN SER A 6 ? UNP Q99459 ? ? 'cloning artifact' 6 6 1 2DIN GLY A 7 ? UNP Q99459 ? ? 'cloning artifact' 7 7 1 2DIN SER A 61 ? UNP Q99459 ? ? 'cloning artifact' 61 8 1 2DIN GLY A 62 ? UNP Q99459 ? ? 'cloning artifact' 62 9 1 2DIN PRO A 63 ? UNP Q99459 ? ? 'cloning artifact' 63 10 1 2DIN SER A 64 ? UNP Q99459 ? ? 'cloning artifact' 64 11 1 2DIN SER A 65 ? UNP Q99459 ? ? 'cloning artifact' 65 12 1 2DIN GLY A 66 ? UNP Q99459 ? ? 'cloning artifact' 66 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1.13mM Myb_DNA-binding domain U-15N, 13C; 20mM d-Tris HCl (pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2DIN _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2DIN _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DIN _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9736 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2DIN _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2DIN _struct.title 'Solution structure of the Myb_DNA-binding domain of human Cell division cycle 5-like protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DIN _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text ;Myb_DNA-binding domain, Cell cycle, DNA binding, Spliceosome, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA binding protein ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 13 ? MET A 27 ? SER A 13 MET A 27 1 ? 15 HELX_P HELX_P2 2 GLN A 30 ? GLY A 39 ? GLN A 30 GLY A 39 1 ? 10 HELX_P HELX_P3 3 THR A 41 ? ARG A 59 ? THR A 41 ARG A 59 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2DIN _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DIN _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 TRP 12 12 12 TRP TRP A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 MET 27 27 27 MET MET A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 TRP 31 31 31 TRP TRP A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 GLY 66 66 66 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-04-03 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 59 ? ? -34.58 129.59 2 1 SER A 61 ? ? -38.47 115.85 3 1 SER A 65 ? ? -36.13 102.78 4 2 THR A 10 ? ? -52.09 101.36 5 2 ASP A 60 ? ? -41.73 105.70 6 2 PRO A 63 ? ? -69.75 94.37 7 3 SER A 5 ? ? -171.55 148.56 8 3 ARG A 59 ? ? -61.99 93.95 9 3 SER A 61 ? ? -88.79 42.60 10 4 SER A 5 ? ? -57.08 93.16 11 4 TYR A 49 ? ? -46.63 -71.10 12 4 PRO A 63 ? ? -69.78 96.09 13 6 TYR A 49 ? ? -48.50 -70.71 14 6 ARG A 59 ? ? -46.35 157.22 15 6 SER A 65 ? ? 38.25 42.04 16 7 ASP A 60 ? ? -99.38 41.66 17 7 SER A 64 ? ? -129.33 -58.43 18 8 SER A 2 ? ? -132.38 -47.75 19 8 ARG A 14 ? ? -34.05 -39.72 20 8 TYR A 49 ? ? -43.69 -72.34 21 9 SER A 3 ? ? -57.83 175.30 22 9 ARG A 59 ? ? -34.55 117.29 23 9 SER A 64 ? ? -56.21 101.88 24 10 SER A 6 ? ? -42.03 162.95 25 10 ARG A 14 ? ? -34.77 -33.75 26 10 GLU A 15 ? ? -74.88 -70.20 27 10 PRO A 28 ? ? -69.74 2.07 28 10 PRO A 63 ? ? -69.78 4.33 29 11 ARG A 14 ? ? -36.36 -37.49 30 13 ARG A 59 ? ? -50.37 172.02 31 14 THR A 10 ? ? -82.64 40.67 32 15 SER A 2 ? ? -67.90 89.19 33 15 SER A 3 ? ? -59.77 102.76 34 15 SER A 5 ? ? -162.80 118.18 35 15 LYS A 9 ? ? -44.65 109.96 36 15 GLU A 11 ? ? -42.36 151.85 37 15 SER A 65 ? ? -62.50 90.27 38 16 PRO A 28 ? ? -69.77 1.98 39 16 ARG A 59 ? ? -34.55 138.29 40 16 ASP A 60 ? ? -105.27 41.02 41 16 SER A 61 ? ? -58.03 92.76 42 17 ARG A 59 ? ? -38.19 143.19 43 17 SER A 61 ? ? 34.68 44.66 44 17 SER A 64 ? ? -42.20 152.32 45 18 PRO A 63 ? ? -69.73 89.00 46 19 TYR A 49 ? ? -47.59 -71.68 47 19 ASP A 60 ? ? -83.22 42.28 48 19 PRO A 63 ? ? -69.74 96.34 49 20 LYS A 8 ? ? -104.62 41.47 50 20 THR A 10 ? ? -48.58 103.99 51 20 ARG A 14 ? ? -34.07 -35.25 #