data_2DIZ # _entry.id 2DIZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DIZ pdb_00002diz 10.2210/pdb2diz/pdb RCSB RCSB025468 ? ? WWPDB D_1000025468 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-09-30 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond 9 5 'Structure model' pdbx_entry_details 10 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DIZ _pdbx_database_status.recvd_initial_deposition_date 2006-03-30 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002004474.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tochio, N.' 1 'Koshiba, S.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Yokoyama, S.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title 'The solution structure of the third thioredoxin domain of human Thioredoxin domain-containing protein 5' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tochio, N.' 1 ? primary 'Koshiba, S.' 2 ? primary 'Inoue, M.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Yokoyama, S.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Thioredoxin domain-containing protein 5' _entity.formula_weight 12788.442 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment '3rd thioredoxin domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Thioredoxin-like protein p46, Endoplasmic reticulum protein ERp46' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGTVLALTENNFDDTIAEGITFIKFYAPWCGHCKTLAPTWEELSKKEFPGLAGVKIAEVDCTAERNICSKYSVRG YPTLLLFRGGKKVSEHSGGRDLDSLHRFVLSQAKDEL ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGTVLALTENNFDDTIAEGITFIKFYAPWCGHCKTLAPTWEELSKKEFPGLAGVKIAEVDCTAERNICSKYSVRG YPTLLLFRGGKKVSEHSGGRDLDSLHRFVLSQAKDEL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002004474.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 THR n 1 9 VAL n 1 10 LEU n 1 11 ALA n 1 12 LEU n 1 13 THR n 1 14 GLU n 1 15 ASN n 1 16 ASN n 1 17 PHE n 1 18 ASP n 1 19 ASP n 1 20 THR n 1 21 ILE n 1 22 ALA n 1 23 GLU n 1 24 GLY n 1 25 ILE n 1 26 THR n 1 27 PHE n 1 28 ILE n 1 29 LYS n 1 30 PHE n 1 31 TYR n 1 32 ALA n 1 33 PRO n 1 34 TRP n 1 35 CYS n 1 36 GLY n 1 37 HIS n 1 38 CYS n 1 39 LYS n 1 40 THR n 1 41 LEU n 1 42 ALA n 1 43 PRO n 1 44 THR n 1 45 TRP n 1 46 GLU n 1 47 GLU n 1 48 LEU n 1 49 SER n 1 50 LYS n 1 51 LYS n 1 52 GLU n 1 53 PHE n 1 54 PRO n 1 55 GLY n 1 56 LEU n 1 57 ALA n 1 58 GLY n 1 59 VAL n 1 60 LYS n 1 61 ILE n 1 62 ALA n 1 63 GLU n 1 64 VAL n 1 65 ASP n 1 66 CYS n 1 67 THR n 1 68 ALA n 1 69 GLU n 1 70 ARG n 1 71 ASN n 1 72 ILE n 1 73 CYS n 1 74 SER n 1 75 LYS n 1 76 TYR n 1 77 SER n 1 78 VAL n 1 79 ARG n 1 80 GLY n 1 81 TYR n 1 82 PRO n 1 83 THR n 1 84 LEU n 1 85 LEU n 1 86 LEU n 1 87 PHE n 1 88 ARG n 1 89 GLY n 1 90 GLY n 1 91 LYS n 1 92 LYS n 1 93 VAL n 1 94 SER n 1 95 GLU n 1 96 HIS n 1 97 SER n 1 98 GLY n 1 99 GLY n 1 100 ARG n 1 101 ASP n 1 102 LEU n 1 103 ASP n 1 104 SER n 1 105 LEU n 1 106 HIS n 1 107 ARG n 1 108 PHE n 1 109 VAL n 1 110 LEU n 1 111 SER n 1 112 GLN n 1 113 ALA n 1 114 LYS n 1 115 ASP n 1 116 GLU n 1 117 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene TXNDC5 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cell free synthesis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050302-28 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 TRP 34 34 34 TRP TRP A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 HIS 37 37 37 HIS HIS A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 TRP 45 45 45 TRP TRP A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 CYS 73 73 73 CYS CYS A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 TYR 81 81 81 TYR TYR A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 HIS 106 106 106 HIS HIS A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 LEU 117 117 117 LEU LEU A . n # _exptl.entry_id 2DIZ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2DIZ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2DIZ _struct.title 'The solution structure of the third thioredoxin domain of human Thioredoxin domain-containing protein 5' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DIZ _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text ;Thioredoxin-like protein p46, Endoplasmic reticulum protein ERp46, TLP46, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ELECTRON TRANSPORT ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TXND5_HUMAN _struct_ref.pdbx_db_accession Q8NBS9 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 288 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DIZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 117 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8NBS9 _struct_ref_seq.db_align_beg 288 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 315 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 117 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DIZ GLY A 1 ? UNP Q8NBS9 ? ? 'cloning artifact' 1 1 1 2DIZ SER A 2 ? UNP Q8NBS9 ? ? 'cloning artifact' 2 2 1 2DIZ SER A 3 ? UNP Q8NBS9 ? ? 'cloning artifact' 3 3 1 2DIZ GLY A 4 ? UNP Q8NBS9 ? ? 'cloning artifact' 4 4 1 2DIZ SER A 5 ? UNP Q8NBS9 ? ? 'cloning artifact' 5 5 1 2DIZ SER A 6 ? UNP Q8NBS9 ? ? 'cloning artifact' 6 6 1 2DIZ GLY A 7 ? UNP Q8NBS9 ? ? 'cloning artifact' 7 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PHE A 17 ? GLU A 23 ? PHE A 17 GLU A 23 1 ? 7 HELX_P HELX_P2 2 GLY A 36 ? LYS A 51 ? GLY A 36 LYS A 51 1 ? 16 HELX_P HELX_P3 3 GLU A 69 ? TYR A 76 ? GLU A 69 TYR A 76 1 ? 8 HELX_P HELX_P4 4 ASP A 101 ? LYS A 114 ? ASP A 101 LYS A 114 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 66 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 73 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 66 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 73 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.998 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 66 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 73 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 66 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 73 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 81 A . ? TYR 81 A PRO 82 A ? PRO 82 A 1 -0.03 2 TYR 81 A . ? TYR 81 A PRO 82 A ? PRO 82 A 2 -0.04 3 TYR 81 A . ? TYR 81 A PRO 82 A ? PRO 82 A 3 -0.07 4 TYR 81 A . ? TYR 81 A PRO 82 A ? PRO 82 A 4 -0.06 5 TYR 81 A . ? TYR 81 A PRO 82 A ? PRO 82 A 5 0.00 6 TYR 81 A . ? TYR 81 A PRO 82 A ? PRO 82 A 6 -0.02 7 TYR 81 A . ? TYR 81 A PRO 82 A ? PRO 82 A 7 -0.10 8 TYR 81 A . ? TYR 81 A PRO 82 A ? PRO 82 A 8 -0.01 9 TYR 81 A . ? TYR 81 A PRO 82 A ? PRO 82 A 9 -0.03 10 TYR 81 A . ? TYR 81 A PRO 82 A ? PRO 82 A 10 -0.02 11 TYR 81 A . ? TYR 81 A PRO 82 A ? PRO 82 A 11 0.01 12 TYR 81 A . ? TYR 81 A PRO 82 A ? PRO 82 A 12 -0.06 13 TYR 81 A . ? TYR 81 A PRO 82 A ? PRO 82 A 13 -0.01 14 TYR 81 A . ? TYR 81 A PRO 82 A ? PRO 82 A 14 -0.11 15 TYR 81 A . ? TYR 81 A PRO 82 A ? PRO 82 A 15 -0.01 16 TYR 81 A . ? TYR 81 A PRO 82 A ? PRO 82 A 16 -0.14 17 TYR 81 A . ? TYR 81 A PRO 82 A ? PRO 82 A 17 0.02 18 TYR 81 A . ? TYR 81 A PRO 82 A ? PRO 82 A 18 -0.19 19 TYR 81 A . ? TYR 81 A PRO 82 A ? PRO 82 A 19 0.06 20 TYR 81 A . ? TYR 81 A PRO 82 A ? PRO 82 A 20 -0.08 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 10 ? ALA A 11 ? LEU A 10 ALA A 11 A 2 LYS A 60 ? ASP A 65 ? LYS A 60 ASP A 65 A 3 THR A 26 ? TYR A 31 ? THR A 26 TYR A 31 A 4 THR A 83 ? LEU A 85 ? THR A 83 LEU A 85 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 10 ? N LEU A 10 O ILE A 61 ? O ILE A 61 A 2 3 O LYS A 60 ? O LYS A 60 N PHE A 27 ? N PHE A 27 A 3 4 N PHE A 30 ? N PHE A 30 O THR A 83 ? O THR A 83 # _pdbx_entry_details.entry_id 2DIZ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -48.40 153.34 2 1 PRO A 33 ? ? -69.78 1.44 3 1 SER A 77 ? ? 34.93 45.55 4 1 VAL A 93 ? ? -105.06 -61.56 5 1 LEU A 102 ? ? -36.56 -36.52 6 1 LYS A 114 ? ? -37.05 112.51 7 2 SER A 5 ? ? -68.55 92.93 8 2 SER A 6 ? ? -54.85 171.37 9 2 PRO A 33 ? ? -69.69 2.51 10 2 LYS A 51 ? ? -43.35 157.96 11 2 GLU A 69 ? ? -118.21 74.34 12 2 SER A 77 ? ? 34.51 47.62 13 2 ALA A 113 ? ? -92.90 31.89 14 3 SER A 3 ? ? -60.85 99.78 15 3 THR A 8 ? ? -128.20 -68.47 16 3 GLU A 69 ? ? -111.27 69.25 17 3 SER A 77 ? ? 34.42 40.90 18 3 VAL A 93 ? ? -128.48 -56.67 19 4 SER A 3 ? ? -47.23 153.11 20 4 THR A 8 ? ? -129.76 -52.04 21 4 ALA A 11 ? ? -57.90 92.31 22 4 THR A 20 ? ? -61.34 -70.22 23 4 PRO A 33 ? ? -69.76 1.70 24 4 SER A 77 ? ? 38.40 31.16 25 4 VAL A 93 ? ? -122.83 -58.80 26 4 HIS A 96 ? ? -46.74 103.14 27 4 SER A 97 ? ? -109.22 76.96 28 4 LYS A 114 ? ? -47.19 99.30 29 5 THR A 8 ? ? -130.73 -57.23 30 5 PRO A 33 ? ? -69.85 2.49 31 5 SER A 77 ? ? 34.29 48.00 32 5 VAL A 93 ? ? -108.49 -60.86 33 5 HIS A 96 ? ? -59.78 108.62 34 5 ARG A 100 ? ? -85.85 44.37 35 5 LYS A 114 ? ? -38.22 113.03 36 6 SER A 5 ? ? -172.12 131.58 37 6 LYS A 51 ? ? -56.61 177.62 38 6 SER A 77 ? ? 42.16 27.58 39 6 LYS A 92 ? ? -39.18 158.55 40 6 VAL A 93 ? ? -123.10 -59.43 41 6 ALA A 113 ? ? -87.93 31.22 42 6 ASP A 115 ? ? -87.86 38.99 43 7 SER A 3 ? ? -58.90 108.56 44 7 PRO A 33 ? ? -69.74 1.45 45 7 LYS A 51 ? ? -49.38 164.34 46 7 GLU A 69 ? ? -111.86 68.79 47 7 ARG A 100 ? ? -99.87 49.54 48 8 ALA A 11 ? ? -67.73 98.20 49 8 PRO A 33 ? ? -69.74 1.00 50 8 CYS A 66 ? ? -84.87 33.65 51 8 THR A 67 ? ? -131.41 -31.80 52 8 ASN A 71 ? ? -33.85 -39.99 53 8 SER A 77 ? ? 39.58 38.09 54 8 ARG A 100 ? ? -90.69 44.01 55 8 LYS A 114 ? ? -61.43 88.40 56 9 PRO A 33 ? ? -69.74 1.98 57 9 LYS A 51 ? ? -38.37 150.95 58 9 SER A 77 ? ? 36.45 38.80 59 9 LYS A 114 ? ? -69.55 90.68 60 10 SER A 2 ? ? -88.64 42.26 61 10 THR A 8 ? ? -130.32 -61.57 62 10 PRO A 33 ? ? -69.73 1.08 63 10 LYS A 51 ? ? -46.99 159.76 64 10 SER A 77 ? ? 37.44 41.14 65 10 SER A 104 ? ? -48.47 -19.53 66 10 ALA A 113 ? ? -83.76 33.07 67 11 GLU A 14 ? ? -83.74 35.60 68 11 ASN A 15 ? ? -133.51 -40.90 69 11 PHE A 17 ? ? -34.96 -32.36 70 11 PRO A 33 ? ? -69.79 1.76 71 11 LYS A 51 ? ? -52.05 172.16 72 11 SER A 77 ? ? 34.61 41.88 73 11 ARG A 100 ? ? -96.46 44.49 74 11 ASP A 115 ? ? -38.72 127.28 75 12 SER A 6 ? ? -47.77 160.91 76 12 PRO A 33 ? ? -69.70 0.57 77 12 LYS A 51 ? ? -47.74 167.08 78 12 GLU A 69 ? ? -97.04 40.79 79 12 HIS A 96 ? ? -64.95 97.00 80 12 SER A 97 ? ? -113.96 69.20 81 12 ARG A 100 ? ? -105.34 42.55 82 12 LYS A 114 ? ? -62.82 79.27 83 12 GLU A 116 ? ? -61.76 89.93 84 13 THR A 8 ? ? -129.04 -53.49 85 13 ALA A 11 ? ? -60.14 87.77 86 13 LYS A 51 ? ? -45.89 170.10 87 13 SER A 77 ? ? 36.06 49.31 88 13 VAL A 93 ? ? -120.14 -60.50 89 13 ARG A 100 ? ? -98.84 34.94 90 13 ALA A 113 ? ? -81.03 41.36 91 13 ASP A 115 ? ? -81.91 40.97 92 13 GLU A 116 ? ? 38.53 40.76 93 14 THR A 8 ? ? -128.68 -62.28 94 14 PRO A 33 ? ? -69.73 2.75 95 14 ASN A 71 ? ? -34.34 -37.58 96 14 SER A 77 ? ? 39.38 44.63 97 14 VAL A 93 ? ? -122.29 -62.68 98 15 SER A 5 ? ? -56.61 104.54 99 15 THR A 8 ? ? -100.11 -68.04 100 15 PRO A 33 ? ? -69.74 0.54 101 15 LYS A 51 ? ? -34.35 143.12 102 15 ASN A 71 ? ? -33.60 -39.76 103 15 SER A 77 ? ? 34.46 32.79 104 15 ARG A 100 ? ? -84.52 46.14 105 15 LYS A 114 ? ? -41.94 105.59 106 15 GLU A 116 ? ? -65.69 77.18 107 16 SER A 2 ? ? -68.27 97.55 108 16 SER A 3 ? ? -66.69 75.13 109 16 THR A 20 ? ? -51.59 -70.65 110 16 PRO A 33 ? ? -69.83 2.98 111 16 LYS A 51 ? ? -36.36 138.89 112 16 CYS A 66 ? ? -86.35 31.06 113 16 GLU A 69 ? ? -104.43 41.51 114 16 SER A 77 ? ? 34.10 35.85 115 16 VAL A 78 ? ? -58.50 85.10 116 16 VAL A 93 ? ? -131.72 -61.55 117 16 ARG A 100 ? ? -98.34 42.26 118 16 LYS A 114 ? ? -34.34 100.30 119 16 ASP A 115 ? ? -54.91 92.67 120 16 GLU A 116 ? ? -82.44 44.34 121 17 GLU A 14 ? ? -84.34 32.89 122 17 ASN A 15 ? ? -133.51 -42.34 123 17 PRO A 33 ? ? -69.72 3.51 124 17 LYS A 51 ? ? -35.04 148.93 125 17 SER A 77 ? ? 35.41 46.20 126 17 VAL A 93 ? ? -124.66 -62.27 127 18 GLU A 14 ? ? -83.78 32.40 128 18 ASN A 15 ? ? -133.26 -38.71 129 18 PHE A 17 ? ? -39.53 -25.94 130 18 PRO A 33 ? ? -69.72 3.91 131 18 LYS A 51 ? ? -37.26 156.12 132 18 PHE A 53 ? ? -35.89 98.33 133 18 GLU A 69 ? ? -105.22 68.61 134 18 SER A 77 ? ? 44.77 25.81 135 18 VAL A 93 ? ? -94.38 -64.87 136 18 ARG A 100 ? ? -94.57 36.29 137 19 PRO A 33 ? ? -69.76 2.73 138 19 LYS A 51 ? ? -46.76 173.53 139 19 GLU A 69 ? ? -101.21 47.13 140 19 SER A 77 ? ? 33.19 41.49 141 19 GLU A 116 ? ? -87.86 42.58 142 20 SER A 3 ? ? -37.79 121.56 143 20 LYS A 51 ? ? -35.49 140.79 144 20 CYS A 66 ? ? -86.90 34.83 145 20 THR A 67 ? ? -133.05 -31.48 146 20 SER A 77 ? ? 37.13 42.67 147 20 HIS A 96 ? ? -61.33 99.75 148 20 SER A 97 ? ? -106.81 72.55 149 20 ARG A 100 ? ? -96.00 36.73 150 20 ALA A 113 ? ? -80.75 46.75 151 20 ASP A 115 ? ? -90.73 37.67 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 2DIZ _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DIZ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1.3mM Thioredoxin domain U-15N,13C; 20mM d-Tris HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_refine.entry_id 2DIZ _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.955 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 PHE N N N N 227 PHE CA C N S 228 PHE C C N N 229 PHE O O N N 230 PHE CB C N N 231 PHE CG C Y N 232 PHE CD1 C Y N 233 PHE CD2 C Y N 234 PHE CE1 C Y N 235 PHE CE2 C Y N 236 PHE CZ C Y N 237 PHE OXT O N N 238 PHE H H N N 239 PHE H2 H N N 240 PHE HA H N N 241 PHE HB2 H N N 242 PHE HB3 H N N 243 PHE HD1 H N N 244 PHE HD2 H N N 245 PHE HE1 H N N 246 PHE HE2 H N N 247 PHE HZ H N N 248 PHE HXT H N N 249 PRO N N N N 250 PRO CA C N S 251 PRO C C N N 252 PRO O O N N 253 PRO CB C N N 254 PRO CG C N N 255 PRO CD C N N 256 PRO OXT O N N 257 PRO H H N N 258 PRO HA H N N 259 PRO HB2 H N N 260 PRO HB3 H N N 261 PRO HG2 H N N 262 PRO HG3 H N N 263 PRO HD2 H N N 264 PRO HD3 H N N 265 PRO HXT H N N 266 SER N N N N 267 SER CA C N S 268 SER C C N N 269 SER O O N N 270 SER CB C N N 271 SER OG O N N 272 SER OXT O N N 273 SER H H N N 274 SER H2 H N N 275 SER HA H N N 276 SER HB2 H N N 277 SER HB3 H N N 278 SER HG H N N 279 SER HXT H N N 280 THR N N N N 281 THR CA C N S 282 THR C C N N 283 THR O O N N 284 THR CB C N R 285 THR OG1 O N N 286 THR CG2 C N N 287 THR OXT O N N 288 THR H H N N 289 THR H2 H N N 290 THR HA H N N 291 THR HB H N N 292 THR HG1 H N N 293 THR HG21 H N N 294 THR HG22 H N N 295 THR HG23 H N N 296 THR HXT H N N 297 TRP N N N N 298 TRP CA C N S 299 TRP C C N N 300 TRP O O N N 301 TRP CB C N N 302 TRP CG C Y N 303 TRP CD1 C Y N 304 TRP CD2 C Y N 305 TRP NE1 N Y N 306 TRP CE2 C Y N 307 TRP CE3 C Y N 308 TRP CZ2 C Y N 309 TRP CZ3 C Y N 310 TRP CH2 C Y N 311 TRP OXT O N N 312 TRP H H N N 313 TRP H2 H N N 314 TRP HA H N N 315 TRP HB2 H N N 316 TRP HB3 H N N 317 TRP HD1 H N N 318 TRP HE1 H N N 319 TRP HE3 H N N 320 TRP HZ2 H N N 321 TRP HZ3 H N N 322 TRP HH2 H N N 323 TRP HXT H N N 324 TYR N N N N 325 TYR CA C N S 326 TYR C C N N 327 TYR O O N N 328 TYR CB C N N 329 TYR CG C Y N 330 TYR CD1 C Y N 331 TYR CD2 C Y N 332 TYR CE1 C Y N 333 TYR CE2 C Y N 334 TYR CZ C Y N 335 TYR OH O N N 336 TYR OXT O N N 337 TYR H H N N 338 TYR H2 H N N 339 TYR HA H N N 340 TYR HB2 H N N 341 TYR HB3 H N N 342 TYR HD1 H N N 343 TYR HD2 H N N 344 TYR HE1 H N N 345 TYR HE2 H N N 346 TYR HH H N N 347 TYR HXT H N N 348 VAL N N N N 349 VAL CA C N S 350 VAL C C N N 351 VAL O O N N 352 VAL CB C N N 353 VAL CG1 C N N 354 VAL CG2 C N N 355 VAL OXT O N N 356 VAL H H N N 357 VAL H2 H N N 358 VAL HA H N N 359 VAL HB H N N 360 VAL HG11 H N N 361 VAL HG12 H N N 362 VAL HG13 H N N 363 VAL HG21 H N N 364 VAL HG22 H N N 365 VAL HG23 H N N 366 VAL HXT H N N 367 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 PHE N CA sing N N 216 PHE N H sing N N 217 PHE N H2 sing N N 218 PHE CA C sing N N 219 PHE CA CB sing N N 220 PHE CA HA sing N N 221 PHE C O doub N N 222 PHE C OXT sing N N 223 PHE CB CG sing N N 224 PHE CB HB2 sing N N 225 PHE CB HB3 sing N N 226 PHE CG CD1 doub Y N 227 PHE CG CD2 sing Y N 228 PHE CD1 CE1 sing Y N 229 PHE CD1 HD1 sing N N 230 PHE CD2 CE2 doub Y N 231 PHE CD2 HD2 sing N N 232 PHE CE1 CZ doub Y N 233 PHE CE1 HE1 sing N N 234 PHE CE2 CZ sing Y N 235 PHE CE2 HE2 sing N N 236 PHE CZ HZ sing N N 237 PHE OXT HXT sing N N 238 PRO N CA sing N N 239 PRO N CD sing N N 240 PRO N H sing N N 241 PRO CA C sing N N 242 PRO CA CB sing N N 243 PRO CA HA sing N N 244 PRO C O doub N N 245 PRO C OXT sing N N 246 PRO CB CG sing N N 247 PRO CB HB2 sing N N 248 PRO CB HB3 sing N N 249 PRO CG CD sing N N 250 PRO CG HG2 sing N N 251 PRO CG HG3 sing N N 252 PRO CD HD2 sing N N 253 PRO CD HD3 sing N N 254 PRO OXT HXT sing N N 255 SER N CA sing N N 256 SER N H sing N N 257 SER N H2 sing N N 258 SER CA C sing N N 259 SER CA CB sing N N 260 SER CA HA sing N N 261 SER C O doub N N 262 SER C OXT sing N N 263 SER CB OG sing N N 264 SER CB HB2 sing N N 265 SER CB HB3 sing N N 266 SER OG HG sing N N 267 SER OXT HXT sing N N 268 THR N CA sing N N 269 THR N H sing N N 270 THR N H2 sing N N 271 THR CA C sing N N 272 THR CA CB sing N N 273 THR CA HA sing N N 274 THR C O doub N N 275 THR C OXT sing N N 276 THR CB OG1 sing N N 277 THR CB CG2 sing N N 278 THR CB HB sing N N 279 THR OG1 HG1 sing N N 280 THR CG2 HG21 sing N N 281 THR CG2 HG22 sing N N 282 THR CG2 HG23 sing N N 283 THR OXT HXT sing N N 284 TRP N CA sing N N 285 TRP N H sing N N 286 TRP N H2 sing N N 287 TRP CA C sing N N 288 TRP CA CB sing N N 289 TRP CA HA sing N N 290 TRP C O doub N N 291 TRP C OXT sing N N 292 TRP CB CG sing N N 293 TRP CB HB2 sing N N 294 TRP CB HB3 sing N N 295 TRP CG CD1 doub Y N 296 TRP CG CD2 sing Y N 297 TRP CD1 NE1 sing Y N 298 TRP CD1 HD1 sing N N 299 TRP CD2 CE2 doub Y N 300 TRP CD2 CE3 sing Y N 301 TRP NE1 CE2 sing Y N 302 TRP NE1 HE1 sing N N 303 TRP CE2 CZ2 sing Y N 304 TRP CE3 CZ3 doub Y N 305 TRP CE3 HE3 sing N N 306 TRP CZ2 CH2 doub Y N 307 TRP CZ2 HZ2 sing N N 308 TRP CZ3 CH2 sing Y N 309 TRP CZ3 HZ3 sing N N 310 TRP CH2 HH2 sing N N 311 TRP OXT HXT sing N N 312 TYR N CA sing N N 313 TYR N H sing N N 314 TYR N H2 sing N N 315 TYR CA C sing N N 316 TYR CA CB sing N N 317 TYR CA HA sing N N 318 TYR C O doub N N 319 TYR C OXT sing N N 320 TYR CB CG sing N N 321 TYR CB HB2 sing N N 322 TYR CB HB3 sing N N 323 TYR CG CD1 doub Y N 324 TYR CG CD2 sing Y N 325 TYR CD1 CE1 sing Y N 326 TYR CD1 HD1 sing N N 327 TYR CD2 CE2 doub Y N 328 TYR CD2 HD2 sing N N 329 TYR CE1 CZ doub Y N 330 TYR CE1 HE1 sing N N 331 TYR CE2 CZ sing Y N 332 TYR CE2 HE2 sing N N 333 TYR CZ OH sing N N 334 TYR OH HH sing N N 335 TYR OXT HXT sing N N 336 VAL N CA sing N N 337 VAL N H sing N N 338 VAL N H2 sing N N 339 VAL CA C sing N N 340 VAL CA CB sing N N 341 VAL CA HA sing N N 342 VAL C O doub N N 343 VAL C OXT sing N N 344 VAL CB CG1 sing N N 345 VAL CB CG2 sing N N 346 VAL CB HB sing N N 347 VAL CG1 HG11 sing N N 348 VAL CG1 HG12 sing N N 349 VAL CG1 HG13 sing N N 350 VAL CG2 HG21 sing N N 351 VAL CG2 HG22 sing N N 352 VAL CG2 HG23 sing N N 353 VAL OXT HXT sing N N 354 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 900 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2DIZ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #