data_2DJ7 # _entry.id 2DJ7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DJ7 pdb_00002dj7 10.2210/pdb2dj7/pdb RCSB RCSB025476 ? ? WWPDB D_1000025476 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002003873.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DJ7 _pdbx_database_status.recvd_initial_deposition_date 2006-03-31 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Niraula, T.N.' 1 'Sasagawa, A.' 2 'Koshiba, S.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution Structure of 3rd LIM Domain of Actin-binding LIM Protein 3' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Niraula, T.N.' 1 ? primary 'Sasagawa, A.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Yokoyama, S.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Actin-binding LIM protein 3' 8474.518 1 ? ? 'LIM domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Actin-binding LIM protein family member 3, abLIM3' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGKPIKIRGPSHCAGCKEEIKHGQSLLALDKQWHVSCFKCQTCSVILTGEYISKDGVPYCESDYHAQFGSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGKPIKIRGPSHCAGCKEEIKHGQSLLALDKQWHVSCFKCQTCSVILTGEYISKDGVPYCESDYHAQFGSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002003873.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 LYS n 1 9 PRO n 1 10 ILE n 1 11 LYS n 1 12 ILE n 1 13 ARG n 1 14 GLY n 1 15 PRO n 1 16 SER n 1 17 HIS n 1 18 CYS n 1 19 ALA n 1 20 GLY n 1 21 CYS n 1 22 LYS n 1 23 GLU n 1 24 GLU n 1 25 ILE n 1 26 LYS n 1 27 HIS n 1 28 GLY n 1 29 GLN n 1 30 SER n 1 31 LEU n 1 32 LEU n 1 33 ALA n 1 34 LEU n 1 35 ASP n 1 36 LYS n 1 37 GLN n 1 38 TRP n 1 39 HIS n 1 40 VAL n 1 41 SER n 1 42 CYS n 1 43 PHE n 1 44 LYS n 1 45 CYS n 1 46 GLN n 1 47 THR n 1 48 CYS n 1 49 SER n 1 50 VAL n 1 51 ILE n 1 52 LEU n 1 53 THR n 1 54 GLY n 1 55 GLU n 1 56 TYR n 1 57 ILE n 1 58 SER n 1 59 LYS n 1 60 ASP n 1 61 GLY n 1 62 VAL n 1 63 PRO n 1 64 TYR n 1 65 CYS n 1 66 GLU n 1 67 SER n 1 68 ASP n 1 69 TYR n 1 70 HIS n 1 71 ALA n 1 72 GLN n 1 73 PHE n 1 74 GLY n 1 75 SER n 1 76 GLY n 1 77 PRO n 1 78 SER n 1 79 SER n 1 80 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ABLIM3 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cell free synthesis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050111-11 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ABLM3_HUMAN _struct_ref.pdbx_db_accession O94929 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 120 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DJ7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 74 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O94929 _struct_ref_seq.db_align_beg 120 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 135 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 74 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DJ7 GLY A 1 ? UNP O94929 ? ? 'cloning artifact' 1 1 1 2DJ7 SER A 2 ? UNP O94929 ? ? 'cloning artifact' 2 2 1 2DJ7 SER A 3 ? UNP O94929 ? ? 'cloning artifact' 3 3 1 2DJ7 GLY A 4 ? UNP O94929 ? ? 'cloning artifact' 4 4 1 2DJ7 SER A 5 ? UNP O94929 ? ? 'cloning artifact' 5 5 1 2DJ7 SER A 6 ? UNP O94929 ? ? 'cloning artifact' 6 6 1 2DJ7 GLY A 7 ? UNP O94929 ? ? 'cloning artifact' 7 7 1 2DJ7 SER A 75 ? UNP O94929 ? ? 'cloning artifact' 75 8 1 2DJ7 GLY A 76 ? UNP O94929 ? ? 'cloning artifact' 76 9 1 2DJ7 PRO A 77 ? UNP O94929 ? ? 'cloning artifact' 77 10 1 2DJ7 SER A 78 ? UNP O94929 ? ? 'cloning artifact' 78 11 1 2DJ7 SER A 79 ? UNP O94929 ? ? 'cloning artifact' 79 12 1 2DJ7 GLY A 80 ? UNP O94929 ? ? 'cloning artifact' 80 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120 _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.34mM LIM domain, U-13C, 15N; 20mM d-Tris_HCl (pH 7.0); 100mM NaCl; 1mM d-DTT, 0.02% NaN3; 0.05mM ZnCl2; 1mM IDA; 90% H2O, 10% D20' _pdbx_nmr_sample_details.solvent_system '90% H2O, 10% D20' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2DJ7 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2DJ7 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DJ7 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B. A.' 3 'data analysis' KUJIRA 0.955 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guentert, P.' 5 refinement CYANA 2.0.17 'Guentert, P.' 6 # _exptl.entry_id 2DJ7 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2DJ7 _struct.title 'Solution Structure of 3rd LIM Domain of Actin-binding LIM Protein 3' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DJ7 _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text ;LIM domain, Actin-binding LIM protein 3, ZN binding protein, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 67 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id PHE _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 73 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 67 _struct_conf.end_auth_comp_id PHE _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 73 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 18 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 18 A ZN 201 1_555 ? ? ? ? ? ? ? 2.392 ? ? metalc2 metalc ? ? A CYS 21 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 21 A ZN 201 1_555 ? ? ? ? ? ? ? 2.231 ? ? metalc3 metalc ? ? A HIS 39 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 39 A ZN 201 1_555 ? ? ? ? ? ? ? 2.077 ? ? metalc4 metalc ? ? A CYS 42 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 42 A ZN 201 1_555 ? ? ? ? ? ? ? 2.251 ? ? metalc5 metalc ? ? A CYS 45 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 45 A ZN 401 1_555 ? ? ? ? ? ? ? 2.392 ? ? metalc6 metalc ? ? A CYS 48 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 48 A ZN 401 1_555 ? ? ? ? ? ? ? 2.394 ? ? metalc7 metalc ? ? A CYS 65 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 65 A ZN 401 1_555 ? ? ? ? ? ? ? 2.180 ? ? metalc8 metalc ? ? A ASP 68 OD1 ? ? ? 1_555 C ZN . ZN ? ? A ASP 68 A ZN 401 1_555 ? ? ? ? ? ? ? 3.782 ? ? metalc9 metalc ? ? A ASP 68 OD2 ? ? ? 1_555 C ZN . ZN ? ? A ASP 68 A ZN 401 1_555 ? ? ? ? ? ? ? 1.898 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 31 ? ALA A 33 ? LEU A 31 ALA A 33 A 2 LYS A 36 ? TRP A 38 ? LYS A 36 TRP A 38 B 1 ILE A 57 ? LYS A 59 ? ILE A 57 LYS A 59 B 2 VAL A 62 ? TYR A 64 ? VAL A 62 TYR A 64 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 31 ? N LEU A 31 O TRP A 38 ? O TRP A 38 B 1 2 N ILE A 57 ? N ILE A 57 O TYR A 64 ? O TYR A 64 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 18 ? CYS A 18 . ? 1_555 ? 2 AC1 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 3 AC1 4 HIS A 39 ? HIS A 39 . ? 1_555 ? 4 AC1 4 CYS A 42 ? CYS A 42 . ? 1_555 ? 5 AC2 4 CYS A 45 ? CYS A 45 . ? 1_555 ? 6 AC2 4 CYS A 48 ? CYS A 48 . ? 1_555 ? 7 AC2 4 CYS A 65 ? CYS A 65 . ? 1_555 ? 8 AC2 4 ASP A 68 ? ASP A 68 . ? 1_555 ? # _database_PDB_matrix.entry_id 2DJ7 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DJ7 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 TRP 38 38 38 TRP TRP A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 CYS 65 65 65 CYS CYS A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 GLY 80 80 80 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 21 ? A CYS 21 ? 1_555 101.1 ? 2 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 39 ? A HIS 39 ? 1_555 107.2 ? 3 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 39 ? A HIS 39 ? 1_555 101.3 ? 4 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 116.4 ? 5 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 115.3 ? 6 ND1 ? A HIS 39 ? A HIS 39 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 113.8 ? 7 SG ? A CYS 45 ? A CYS 45 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 48 ? A CYS 48 ? 1_555 97.0 ? 8 SG ? A CYS 45 ? A CYS 45 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 65 ? A CYS 65 ? 1_555 114.9 ? 9 SG ? A CYS 48 ? A CYS 48 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 65 ? A CYS 65 ? 1_555 101.9 ? 10 SG ? A CYS 45 ? A CYS 45 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 OD1 ? A ASP 68 ? A ASP 68 ? 1_555 118.4 ? 11 SG ? A CYS 48 ? A CYS 48 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 OD1 ? A ASP 68 ? A ASP 68 ? 1_555 109.9 ? 12 SG ? A CYS 65 ? A CYS 65 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 OD1 ? A ASP 68 ? A ASP 68 ? 1_555 112.0 ? 13 SG ? A CYS 45 ? A CYS 45 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 OD2 ? A ASP 68 ? A ASP 68 ? 1_555 99.3 ? 14 SG ? A CYS 48 ? A CYS 48 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 OD2 ? A ASP 68 ? A ASP 68 ? 1_555 99.7 ? 15 SG ? A CYS 65 ? A CYS 65 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 OD2 ? A ASP 68 ? A ASP 68 ? 1_555 136.4 ? 16 OD1 ? A ASP 68 ? A ASP 68 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 OD2 ? A ASP 68 ? A ASP 68 ? 1_555 24.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-10-01 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 17 4 'Structure model' '_struct_ref_seq_dif.details' 18 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 19 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 20 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 11 ? ? -91.03 39.93 2 1 PRO A 15 ? ? -69.78 -167.99 3 1 CYS A 45 ? ? -48.76 167.20 4 1 ASP A 60 ? ? 41.12 29.46 5 1 SER A 67 ? ? -87.96 -70.92 6 1 SER A 79 ? ? -83.21 47.75 7 2 LYS A 26 ? ? -81.71 39.73 8 2 HIS A 27 ? ? 34.58 40.55 9 2 GLN A 29 ? ? -80.55 42.98 10 2 ASP A 35 ? ? 49.26 25.61 11 2 PHE A 43 ? ? -69.89 97.39 12 2 CYS A 45 ? ? -49.55 166.63 13 2 SER A 49 ? ? 70.72 49.23 14 2 ASP A 60 ? ? 44.11 26.28 15 2 SER A 67 ? ? -87.63 -70.76 16 2 SER A 75 ? ? -171.06 149.06 17 3 SER A 2 ? ? -174.52 118.53 18 3 SER A 5 ? ? -102.22 -62.14 19 3 LYS A 11 ? ? -115.23 51.53 20 3 PRO A 15 ? ? -69.73 -175.79 21 3 GLN A 29 ? ? 35.24 35.63 22 3 ALA A 33 ? ? -172.09 133.69 23 3 SER A 67 ? ? -90.22 -71.19 24 3 PRO A 77 ? ? -69.78 90.52 25 4 PRO A 15 ? ? -69.78 -175.61 26 4 HIS A 27 ? ? -65.09 89.82 27 4 ASP A 60 ? ? 41.82 28.25 28 4 SER A 67 ? ? -88.24 -70.54 29 4 GLN A 72 ? ? -95.75 -62.04 30 4 PRO A 77 ? ? -69.82 11.45 31 4 SER A 78 ? ? -27.46 122.19 32 5 SER A 5 ? ? -173.77 147.06 33 5 ARG A 13 ? ? -175.23 146.94 34 5 PRO A 15 ? ? -69.78 -172.51 35 5 ALA A 33 ? ? -173.27 130.58 36 5 CYS A 45 ? ? -47.72 166.70 37 5 ASP A 60 ? ? 41.72 26.81 38 5 SER A 67 ? ? -88.27 -70.80 39 5 PRO A 77 ? ? -69.78 15.90 40 6 SER A 2 ? ? 37.06 41.56 41 6 PRO A 9 ? ? -69.74 -173.67 42 6 ILE A 12 ? ? -118.74 79.46 43 6 HIS A 27 ? ? -34.52 130.12 44 6 ALA A 33 ? ? -171.89 137.72 45 6 SER A 67 ? ? -89.05 -70.70 46 6 GLN A 72 ? ? -96.64 -63.68 47 7 PRO A 9 ? ? -69.83 -174.18 48 7 ARG A 13 ? ? 34.42 48.14 49 7 HIS A 27 ? ? -37.05 -38.40 50 7 CYS A 45 ? ? -47.49 166.84 51 7 SER A 67 ? ? -90.03 -71.41 52 8 SER A 5 ? ? -171.23 125.90 53 8 HIS A 27 ? ? -68.64 95.47 54 8 CYS A 45 ? ? -49.44 168.03 55 8 SER A 67 ? ? -90.24 -71.96 56 9 SER A 2 ? ? -174.38 126.99 57 9 PRO A 9 ? ? -69.74 -175.83 58 9 ILE A 10 ? ? 27.76 48.19 59 9 LYS A 11 ? ? -80.99 38.39 60 9 CYS A 18 ? ? -39.36 155.72 61 9 HIS A 39 ? ? -58.83 178.02 62 9 SER A 67 ? ? -89.89 -71.54 63 9 GLN A 72 ? ? -91.45 -63.80 64 9 PRO A 77 ? ? -69.77 -172.71 65 9 SER A 79 ? ? 72.82 42.14 66 10 SER A 2 ? ? -160.32 118.70 67 10 PRO A 15 ? ? -69.72 -164.42 68 10 HIS A 27 ? ? -83.46 44.86 69 10 CYS A 45 ? ? -48.73 168.28 70 10 ASP A 60 ? ? 38.84 33.55 71 10 SER A 67 ? ? -89.30 -71.14 72 10 SER A 78 ? ? -53.45 172.50 73 11 SER A 2 ? ? -97.38 42.40 74 11 PRO A 15 ? ? -69.76 81.75 75 11 LYS A 26 ? ? -133.67 -40.18 76 11 CYS A 45 ? ? -48.85 167.51 77 11 THR A 53 ? ? -133.54 -39.30 78 11 SER A 67 ? ? -88.79 -71.37 79 11 GLN A 72 ? ? -90.97 -62.71 80 11 PRO A 77 ? ? -69.78 -178.20 81 12 LYS A 8 ? ? -168.65 111.38 82 12 PRO A 9 ? ? -69.75 -177.29 83 12 LYS A 26 ? ? -34.72 145.33 84 12 ASP A 60 ? ? 38.48 31.48 85 12 SER A 67 ? ? -89.10 -71.06 86 12 PRO A 77 ? ? -69.75 0.08 87 13 SER A 3 ? ? -173.89 147.31 88 13 PRO A 15 ? ? -69.74 -168.29 89 13 ASP A 35 ? ? 49.17 26.56 90 13 CYS A 45 ? ? -44.09 165.67 91 13 THR A 53 ? ? -132.87 -42.40 92 13 SER A 67 ? ? -88.32 -70.73 93 13 GLN A 72 ? ? -96.89 -63.03 94 13 PRO A 77 ? ? -69.76 -179.18 95 13 SER A 79 ? ? 37.75 42.90 96 14 LYS A 11 ? ? -101.68 70.72 97 14 PRO A 15 ? ? -69.73 -175.70 98 14 LYS A 26 ? ? -102.90 70.21 99 14 SER A 67 ? ? -88.97 -71.34 100 14 PRO A 77 ? ? -69.71 98.11 101 15 ILE A 10 ? ? -59.13 -179.87 102 15 PRO A 15 ? ? -69.82 -167.90 103 15 PHE A 43 ? ? -65.02 86.65 104 15 CYS A 45 ? ? -49.53 167.43 105 15 THR A 53 ? ? -132.74 -39.06 106 15 ASP A 60 ? ? 38.52 32.75 107 15 SER A 67 ? ? -90.48 -70.71 108 15 PRO A 77 ? ? -69.81 90.13 109 16 LYS A 26 ? ? -127.95 -60.23 110 16 ASP A 60 ? ? 39.92 26.89 111 16 SER A 67 ? ? -90.48 -71.41 112 16 PRO A 77 ? ? -69.76 -178.17 113 17 PRO A 15 ? ? -69.75 89.18 114 17 LYS A 26 ? ? -130.62 -50.01 115 17 CYS A 45 ? ? -44.21 167.72 116 17 ILE A 51 ? ? -38.94 136.42 117 17 ASP A 60 ? ? 39.57 37.63 118 17 SER A 67 ? ? -88.57 -71.07 119 17 GLN A 72 ? ? -94.51 -64.61 120 17 PRO A 77 ? ? -69.69 81.73 121 18 PRO A 9 ? ? -69.72 97.16 122 18 ILE A 10 ? ? -38.65 -32.29 123 18 LYS A 11 ? ? 70.77 53.76 124 18 GLU A 24 ? ? -37.42 130.31 125 18 LYS A 26 ? ? -78.71 45.00 126 18 HIS A 27 ? ? -133.83 -40.39 127 18 ASP A 35 ? ? 48.17 25.22 128 18 CYS A 45 ? ? -47.43 167.31 129 18 SER A 67 ? ? -90.86 -71.61 130 18 GLN A 72 ? ? -99.11 -62.07 131 19 LYS A 11 ? ? -119.07 53.57 132 19 PRO A 15 ? ? -69.76 -170.28 133 19 CYS A 45 ? ? -45.73 167.33 134 19 SER A 49 ? ? 70.88 53.06 135 19 THR A 53 ? ? -131.95 -39.54 136 19 ASP A 60 ? ? 39.56 37.65 137 19 SER A 67 ? ? -89.69 -71.22 138 20 SER A 2 ? ? -170.74 116.57 139 20 SER A 5 ? ? -171.37 129.79 140 20 ARG A 13 ? ? -171.23 105.92 141 20 PRO A 15 ? ? -69.79 -165.90 142 20 CYS A 18 ? ? -41.38 156.99 143 20 HIS A 27 ? ? -38.47 107.55 144 20 ALA A 33 ? ? -170.70 128.53 145 20 SER A 67 ? ? -90.02 -71.39 146 20 GLN A 72 ? ? -98.12 -64.39 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #