data_2DJ8 # _entry.id 2DJ8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DJ8 pdb_00002dj8 10.2210/pdb2dj8/pdb RCSB RCSB025477 ? ? WWPDB D_1000025477 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002005805.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DJ8 _pdbx_database_status.recvd_initial_deposition_date 2006-03-31 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Niraula, T.N.' 1 'Sasagawa, A.' 2 'Koshiba, S.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution Structure of zf-MYND Domain of Protein CBFA2TI (Protein MTG8)' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Niraula, T.N.' 1 ? primary 'Sasagawa, A.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Yokoyama, S.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein CBFA2T1' 6406.840 1 ? ? zf-MYND ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Protein MTG8, Protein ETO, Eigth twenty one protein, Cyclin D-related protein, Zinc finger MYND domain-containing protein 2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002005805.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 ILE n 1 9 ASN n 1 10 GLN n 1 11 GLN n 1 12 GLU n 1 13 ASP n 1 14 SER n 1 15 SER n 1 16 GLU n 1 17 SER n 1 18 CYS n 1 19 TRP n 1 20 ASN n 1 21 CYS n 1 22 GLY n 1 23 ARG n 1 24 LYS n 1 25 ALA n 1 26 SER n 1 27 GLU n 1 28 THR n 1 29 CYS n 1 30 SER n 1 31 GLY n 1 32 CYS n 1 33 ASN n 1 34 THR n 1 35 ALA n 1 36 ARG n 1 37 TYR n 1 38 CYS n 1 39 GLY n 1 40 SER n 1 41 PHE n 1 42 CYS n 1 43 GLN n 1 44 HIS n 1 45 LYS n 1 46 ASP n 1 47 TRP n 1 48 GLU n 1 49 LYS n 1 50 HIS n 1 51 HIS n 1 52 HIS n 1 53 ILE n 1 54 CYS n 1 55 SER n 1 56 GLY n 1 57 PRO n 1 58 SER n 1 59 SER n 1 60 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene RUNX1T1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cell free synthesis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050302-54 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MTG8_HUMAN _struct_ref.pdbx_db_accession Q06455 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 449 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DJ8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 54 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q06455 _struct_ref_seq.db_align_beg 449 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 450 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 54 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DJ8 GLY A 1 ? UNP Q06455 ? ? 'cloning artifact' 1 1 1 2DJ8 SER A 2 ? UNP Q06455 ? ? 'cloning artifact' 2 2 1 2DJ8 SER A 3 ? UNP Q06455 ? ? 'cloning artifact' 3 3 1 2DJ8 GLY A 4 ? UNP Q06455 ? ? 'cloning artifact' 4 4 1 2DJ8 SER A 5 ? UNP Q06455 ? ? 'cloning artifact' 5 5 1 2DJ8 SER A 6 ? UNP Q06455 ? ? 'cloning artifact' 6 6 1 2DJ8 GLY A 7 ? UNP Q06455 ? ? 'cloning artifact' 7 7 1 2DJ8 SER A 55 ? UNP Q06455 ? ? 'cloning artifact' 55 8 1 2DJ8 GLY A 56 ? UNP Q06455 ? ? 'cloning artifact' 56 9 1 2DJ8 PRO A 57 ? UNP Q06455 ? ? 'cloning artifact' 57 10 1 2DJ8 SER A 58 ? UNP Q06455 ? ? 'cloning artifact' 58 11 1 2DJ8 SER A 59 ? UNP Q06455 ? ? 'cloning artifact' 59 12 1 2DJ8 GLY A 60 ? UNP Q06455 ? ? 'cloning artifact' 60 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120 _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;0.95mM zf-MYND domain, U-13C, 15N; 20mM d-Tris_HCl (pH 7.0); 100mM NaCl; 1mM d-DTT, 0.02% NaN3; 0.05mM ZnCl2; 1mM IDA; 90% H2O, 10% D20 ; _pdbx_nmr_sample_details.solvent_system '90% H2O, 10% D20' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2DJ8 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2DJ8 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DJ8 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B. A.' 3 'data analysis' KUJIRA 0.955 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guentert, P.' 5 refinement CYANA 2.0.17 'Guentert, P.' 6 # _exptl.entry_id 2DJ8 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2DJ8 _struct.title 'Solution Structure of zf-MYND Domain of Protein CBFA2TI (Protein MTG8)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DJ8 _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text ;Zinc finger MYND domain, Protein MTG8, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 39 ? ASP A 46 ? GLY A 39 ASP A 46 1 ? 8 HELX_P HELX_P2 2 ASP A 46 ? HIS A 51 ? ASP A 46 HIS A 51 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 18 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 18 A ZN 201 1_555 ? ? ? ? ? ? ? 2.222 ? ? metalc2 metalc ? ? A CYS 21 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 21 A ZN 201 1_555 ? ? ? ? ? ? ? 2.392 ? ? metalc3 metalc ? ? A CYS 29 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 29 A ZN 401 1_555 ? ? ? ? ? ? ? 2.190 ? ? metalc4 metalc ? ? A CYS 32 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 32 A ZN 401 1_555 ? ? ? ? ? ? ? 2.314 ? ? metalc5 metalc ? ? A CYS 38 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 38 A ZN 201 1_555 ? ? ? ? ? ? ? 2.392 ? ? metalc6 metalc ? ? A CYS 42 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 42 A ZN 201 1_555 ? ? ? ? ? ? ? 2.394 ? ? metalc7 metalc ? ? A HIS 50 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 50 A ZN 401 1_555 ? ? ? ? ? ? ? 2.099 ? ? metalc8 metalc ? ? A CYS 54 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 54 A ZN 401 1_555 ? ? ? ? ? ? ? 2.394 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 27 ? THR A 28 ? GLU A 27 THR A 28 A 2 ARG A 36 ? TYR A 37 ? ARG A 36 TYR A 37 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id GLU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 27 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id GLU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 27 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id TYR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 37 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 37 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 18 ? CYS A 18 . ? 1_555 ? 2 AC1 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 3 AC1 4 CYS A 38 ? CYS A 38 . ? 1_555 ? 4 AC1 4 CYS A 42 ? CYS A 42 . ? 1_555 ? 5 AC2 4 CYS A 29 ? CYS A 29 . ? 1_555 ? 6 AC2 4 CYS A 32 ? CYS A 32 . ? 1_555 ? 7 AC2 4 HIS A 50 ? HIS A 50 . ? 1_555 ? 8 AC2 4 CYS A 54 ? CYS A 54 . ? 1_555 ? # _database_PDB_matrix.entry_id 2DJ8 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DJ8 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 TRP 19 19 19 TRP TRP A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 TRP 47 47 47 TRP TRP A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 HIS 50 50 50 HIS HIS A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 GLY 60 60 60 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 21 ? A CYS 21 ? 1_555 118.1 ? 2 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 38 ? A CYS 38 ? 1_555 117.4 ? 3 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 38 ? A CYS 38 ? 1_555 106.4 ? 4 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 100.6 ? 5 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 108.5 ? 6 SG ? A CYS 38 ? A CYS 38 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 104.5 ? 7 SG ? A CYS 29 ? A CYS 29 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 32 ? A CYS 32 ? 1_555 105.1 ? 8 SG ? A CYS 29 ? A CYS 29 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 50 ? A HIS 50 ? 1_555 120.6 ? 9 SG ? A CYS 32 ? A CYS 32 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 50 ? A HIS 50 ? 1_555 100.3 ? 10 SG ? A CYS 29 ? A CYS 29 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 54 ? A CYS 54 ? 1_555 120.6 ? 11 SG ? A CYS 32 ? A CYS 32 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 54 ? A CYS 54 ? 1_555 114.5 ? 12 NE2 ? A HIS 50 ? A HIS 50 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 54 ? A CYS 54 ? 1_555 94.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-10-01 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_conn_angle 6 4 'Structure model' pdbx_struct_oper_list 7 4 'Structure model' struct_conn 8 4 'Structure model' struct_ref_seq_dif 9 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.value' 16 4 'Structure model' '_struct_conn.pdbx_dist_value' 17 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 29 4 'Structure model' '_struct_ref_seq_dif.details' 30 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 31 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 32 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HE2 A HIS 50 ? ? ZN A ZN 401 ? ? 1.26 2 2 HE2 A HIS 50 ? ? ZN A ZN 401 ? ? 1.25 3 3 HE2 A HIS 50 ? ? ZN A ZN 401 ? ? 1.19 4 4 HE2 A HIS 50 ? ? ZN A ZN 401 ? ? 1.20 5 5 HE2 A HIS 50 ? ? ZN A ZN 401 ? ? 1.20 6 6 HE2 A HIS 50 ? ? ZN A ZN 401 ? ? 1.16 7 7 HE2 A HIS 50 ? ? ZN A ZN 401 ? ? 1.19 8 8 HE2 A HIS 50 ? ? ZN A ZN 401 ? ? 1.27 9 9 HE2 A HIS 50 ? ? ZN A ZN 401 ? ? 1.24 10 10 HE2 A HIS 50 ? ? ZN A ZN 401 ? ? 1.26 11 11 HE2 A HIS 50 ? ? ZN A ZN 401 ? ? 1.28 12 12 HE2 A HIS 50 ? ? ZN A ZN 401 ? ? 1.22 13 13 HE2 A HIS 50 ? ? ZN A ZN 401 ? ? 1.25 14 14 HE2 A HIS 50 ? ? ZN A ZN 401 ? ? 1.20 15 15 HE2 A HIS 50 ? ? ZN A ZN 401 ? ? 1.19 16 16 HE2 A HIS 50 ? ? ZN A ZN 401 ? ? 1.14 17 17 HE2 A HIS 50 ? ? ZN A ZN 401 ? ? 1.19 18 18 HE2 A HIS 50 ? ? ZN A ZN 401 ? ? 1.18 19 19 HE2 A HIS 50 ? ? ZN A ZN 401 ? ? 1.26 20 20 HE2 A HIS 50 ? ? ZN A ZN 401 ? ? 1.22 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 3 ? ? -174.56 141.93 2 1 ASP A 13 ? ? -165.28 106.34 3 1 SER A 15 ? ? -95.45 45.75 4 1 ASN A 20 ? ? -60.15 -74.46 5 1 CYS A 21 ? ? -70.90 -71.60 6 1 SER A 30 ? ? -83.06 31.02 7 2 SER A 3 ? ? -101.89 42.07 8 2 GLU A 16 ? ? -98.58 40.20 9 2 ASN A 20 ? ? -63.18 -74.37 10 2 CYS A 21 ? ? -69.44 -71.52 11 2 SER A 30 ? ? -82.34 31.90 12 2 SER A 58 ? ? -79.15 46.81 13 3 ASP A 13 ? ? -172.35 112.22 14 3 SER A 15 ? ? -105.51 45.72 15 3 GLU A 16 ? ? -170.06 116.88 16 3 SER A 17 ? ? -173.04 125.62 17 3 ASN A 20 ? ? -66.64 -75.52 18 3 CYS A 21 ? ? -67.72 -70.98 19 3 SER A 30 ? ? -82.31 32.20 20 3 GLU A 48 ? ? -39.36 -25.31 21 3 PRO A 57 ? ? -69.70 3.22 22 4 GLU A 16 ? ? -87.02 45.38 23 4 ASN A 20 ? ? -68.47 -75.19 24 4 ARG A 23 ? ? -68.30 -70.81 25 4 SER A 30 ? ? -82.19 32.52 26 4 TRP A 47 ? ? -90.10 -66.97 27 4 SER A 59 ? ? -92.91 -60.32 28 5 SER A 3 ? ? -174.53 134.39 29 5 ASN A 9 ? ? -170.52 108.17 30 5 GLU A 12 ? ? -168.41 108.62 31 5 ASP A 13 ? ? -174.82 130.99 32 5 SER A 14 ? ? -38.54 103.76 33 5 ASN A 20 ? ? -65.59 -74.95 34 5 CYS A 21 ? ? -68.73 -71.30 35 5 ARG A 23 ? ? -48.83 -72.54 36 5 SER A 30 ? ? -81.57 31.35 37 6 GLN A 10 ? ? -95.91 38.09 38 6 GLN A 11 ? ? -36.04 120.64 39 6 GLU A 16 ? ? -167.47 105.67 40 6 ASN A 20 ? ? -65.87 -74.89 41 6 CYS A 21 ? ? -68.44 -71.18 42 6 ARG A 23 ? ? -47.50 -75.11 43 6 PRO A 57 ? ? -69.67 2.20 44 7 SER A 6 ? ? -129.85 -54.80 45 7 GLU A 12 ? ? -172.03 109.25 46 7 ASP A 13 ? ? -133.59 -45.92 47 7 ASN A 20 ? ? -61.56 -74.13 48 7 CYS A 21 ? ? -70.48 -71.20 49 7 ARG A 23 ? ? -51.50 -70.88 50 7 SER A 30 ? ? -81.20 34.14 51 7 SER A 58 ? ? -173.67 140.63 52 8 ILE A 8 ? ? -130.10 -33.43 53 8 GLN A 11 ? ? -160.33 112.77 54 8 SER A 14 ? ? 35.08 46.61 55 8 ASN A 20 ? ? -62.08 -75.70 56 8 CYS A 21 ? ? -64.61 -70.03 57 8 ARG A 23 ? ? -74.23 -71.40 58 8 TRP A 47 ? ? -85.25 -70.15 59 8 GLU A 48 ? ? -38.96 -25.70 60 9 ASN A 20 ? ? -67.37 -74.72 61 9 CYS A 21 ? ? -68.22 -70.89 62 9 ARG A 23 ? ? -55.40 -70.37 63 9 PRO A 57 ? ? -69.71 8.87 64 10 SER A 5 ? ? -174.63 133.77 65 10 ASN A 20 ? ? -61.45 -75.19 66 10 CYS A 21 ? ? -68.87 -71.85 67 10 SER A 30 ? ? -81.66 38.35 68 10 TRP A 47 ? ? -91.65 -64.27 69 11 ASP A 13 ? ? -167.01 114.85 70 11 ASN A 20 ? ? -62.43 -74.73 71 11 CYS A 21 ? ? -69.88 -71.65 72 11 SER A 30 ? ? -80.64 38.99 73 12 GLN A 10 ? ? -120.65 -58.27 74 12 SER A 14 ? ? -115.99 51.58 75 12 ASN A 20 ? ? -60.50 -75.19 76 12 CYS A 21 ? ? -69.34 -72.09 77 12 ARG A 23 ? ? -48.46 -74.23 78 12 CYS A 29 ? ? -53.74 108.15 79 12 PRO A 57 ? ? -69.81 -165.52 80 12 SER A 58 ? ? -104.34 40.54 81 12 SER A 59 ? ? -122.60 -57.67 82 13 ASN A 9 ? ? -47.81 153.25 83 13 GLU A 16 ? ? 41.81 27.60 84 13 ASN A 20 ? ? -60.84 -75.40 85 13 CYS A 21 ? ? -62.04 -71.47 86 13 ARG A 23 ? ? -131.96 -67.34 87 13 GLU A 48 ? ? -48.59 -18.63 88 13 PRO A 57 ? ? -69.71 93.45 89 14 SER A 5 ? ? -170.89 142.37 90 14 ASN A 20 ? ? -66.84 -74.93 91 14 CYS A 21 ? ? -68.63 -70.98 92 14 SER A 30 ? ? -80.16 38.03 93 14 GLU A 48 ? ? -38.73 -26.01 94 14 PRO A 57 ? ? -69.77 -172.68 95 14 SER A 58 ? ? -33.14 148.52 96 14 SER A 59 ? ? -78.19 47.66 97 15 ILE A 8 ? ? 32.82 52.78 98 15 ASN A 9 ? ? -174.66 109.26 99 15 SER A 15 ? ? -133.92 -35.71 100 15 GLU A 16 ? ? -90.67 30.13 101 15 ASN A 20 ? ? -58.62 -75.48 102 15 CYS A 21 ? ? -65.15 -71.44 103 15 ARG A 23 ? ? -70.34 -74.98 104 15 GLU A 48 ? ? -39.35 -25.17 105 15 SER A 58 ? ? -35.27 103.25 106 16 SER A 5 ? ? -162.98 111.16 107 16 ASP A 13 ? ? 35.31 39.65 108 16 SER A 14 ? ? -37.69 138.28 109 16 ASN A 20 ? ? -63.62 -74.27 110 16 CYS A 21 ? ? -68.90 -71.58 111 16 SER A 30 ? ? -82.02 34.86 112 16 SER A 58 ? ? -172.82 117.78 113 16 SER A 59 ? ? -87.37 41.33 114 17 GLN A 10 ? ? -66.32 80.09 115 17 ASP A 13 ? ? -127.79 -53.13 116 17 ASN A 20 ? ? -62.60 -74.27 117 17 CYS A 21 ? ? -69.53 -71.43 118 17 SER A 30 ? ? -81.10 33.92 119 17 PRO A 57 ? ? -69.79 85.51 120 17 SER A 58 ? ? 34.19 42.78 121 18 ASN A 20 ? ? -69.28 -75.09 122 18 CYS A 21 ? ? -63.18 -71.54 123 18 ARG A 23 ? ? -84.85 -74.97 124 19 ASN A 20 ? ? -67.90 -75.58 125 19 CYS A 21 ? ? -65.01 -70.94 126 19 ARG A 23 ? ? -60.21 -73.55 127 19 GLU A 48 ? ? -39.83 -24.45 128 20 ASP A 13 ? ? -171.91 135.53 129 20 ASN A 20 ? ? -69.66 -74.20 130 20 CYS A 21 ? ? -70.01 -70.30 131 20 ARG A 23 ? ? -53.41 -70.32 132 20 SER A 30 ? ? -80.51 35.23 133 20 PRO A 57 ? ? -69.76 -179.98 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #