data_2DKL # _entry.id 2DKL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DKL pdb_00002dkl 10.2210/pdb2dkl/pdb RCSB RCSB025525 ? ? WWPDB D_1000025525 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk002101554.5 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DKL _pdbx_database_status.recvd_initial_deposition_date 2006-04-12 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhao, C.' 1 'Kigawa, T.' 2 'Yoneyama, M.' 3 'Koshiba, S.' 4 'Harada, T.' 5 'Watanabe, S.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution Structure of the UBA Domain in the Human Trinucleotide Repeat Containing 6C Protein (hTNRC6C)' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhao, C.' 1 ? primary 'Kigawa, T.' 2 ? primary 'Yoneyama, M.' 3 ? primary 'Koshiba, S.' 4 ? primary 'Harada, T.' 5 ? primary 'Watanabe, S.' 6 ? primary 'Yokoyama, S.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Trinucleotide Repeat Containing 6C Protein' _entity.formula_weight 8952.071 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UBA domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'KIAA1582 protein, TNRC6C' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGGMKTSGKQDEAWIMSRLIKQLTDMGFPREPAEEALKSNNMNLDQAMSALLEKKVDVDKRGLGVTDHNGMAAKS GPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGGMKTSGKQDEAWIMSRLIKQLTDMGFPREPAEEALKSNNMNLDQAMSALLEKKVDVDKRGLGVTDHNGMAAKS GPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk002101554.5 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLY n 1 9 MET n 1 10 LYS n 1 11 THR n 1 12 SER n 1 13 GLY n 1 14 LYS n 1 15 GLN n 1 16 ASP n 1 17 GLU n 1 18 ALA n 1 19 TRP n 1 20 ILE n 1 21 MET n 1 22 SER n 1 23 ARG n 1 24 LEU n 1 25 ILE n 1 26 LYS n 1 27 GLN n 1 28 LEU n 1 29 THR n 1 30 ASP n 1 31 MET n 1 32 GLY n 1 33 PHE n 1 34 PRO n 1 35 ARG n 1 36 GLU n 1 37 PRO n 1 38 ALA n 1 39 GLU n 1 40 GLU n 1 41 ALA n 1 42 LEU n 1 43 LYS n 1 44 SER n 1 45 ASN n 1 46 ASN n 1 47 MET n 1 48 ASN n 1 49 LEU n 1 50 ASP n 1 51 GLN n 1 52 ALA n 1 53 MET n 1 54 SER n 1 55 ALA n 1 56 LEU n 1 57 LEU n 1 58 GLU n 1 59 LYS n 1 60 LYS n 1 61 VAL n 1 62 ASP n 1 63 VAL n 1 64 ASP n 1 65 LYS n 1 66 ARG n 1 67 GLY n 1 68 LEU n 1 69 GLY n 1 70 VAL n 1 71 THR n 1 72 ASP n 1 73 HIS n 1 74 ASN n 1 75 GLY n 1 76 MET n 1 77 ALA n 1 78 ALA n 1 79 LYS n 1 80 SER n 1 81 GLY n 1 82 PRO n 1 83 SER n 1 84 SER n 1 85 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene KIAA1582 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cell free synthesis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P051216-11 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q86UE5_HUMAN _struct_ref.pdbx_db_accession Q86UE5 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 197 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DKL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 79 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q86UE5 _struct_ref_seq.db_align_beg 197 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 268 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 79 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DKL GLY A 1 ? UNP Q86UE5 ? ? 'cloning artifact' 1 1 1 2DKL SER A 2 ? UNP Q86UE5 ? ? 'cloning artifact' 2 2 1 2DKL SER A 3 ? UNP Q86UE5 ? ? 'cloning artifact' 3 3 1 2DKL GLY A 4 ? UNP Q86UE5 ? ? 'cloning artifact' 4 4 1 2DKL SER A 5 ? UNP Q86UE5 ? ? 'cloning artifact' 5 5 1 2DKL SER A 6 ? UNP Q86UE5 ? ? 'cloning artifact' 6 6 1 2DKL GLY A 7 ? UNP Q86UE5 ? ? 'cloning artifact' 7 7 1 2DKL SER A 80 ? UNP Q86UE5 ? ? 'cloning artifact' 80 8 1 2DKL GLY A 81 ? UNP Q86UE5 ? ? 'cloning artifact' 81 9 1 2DKL PRO A 82 ? UNP Q86UE5 ? ? 'cloning artifact' 82 10 1 2DKL SER A 83 ? UNP Q86UE5 ? ? 'cloning artifact' 83 11 1 2DKL SER A 84 ? UNP Q86UE5 ? ? 'cloning artifact' 84 12 1 2DKL GLY A 85 ? UNP Q86UE5 ? ? 'cloning artifact' 85 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1.13mM UBA domain U-15N, 13C; 20mM d-Tris-HCl (pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2DKL _pdbx_nmr_refine.method 'torsion angle dynamics, restrained molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2DKL _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DKL _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.6 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9732 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2DKL _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2DKL _struct.title 'Solution Structure of the UBA Domain in the Human Trinucleotide Repeat Containing 6C Protein (hTNRC6C)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DKL _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text ;Trinucleotide Repeat Containing 6C Protein, TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 16 ? GLY A 32 ? ASP A 16 GLY A 32 1 ? 17 HELX_P HELX_P2 2 PRO A 34 ? ASN A 45 ? PRO A 34 ASN A 45 1 ? 12 HELX_P HELX_P3 3 ASN A 48 ? GLU A 58 ? ASN A 48 GLU A 58 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2DKL _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DKL _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 TRP 19 19 19 TRP TRP A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 MET 31 31 31 MET MET A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 MET 53 53 53 MET MET A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 MET 76 76 76 MET MET A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 GLY 85 85 85 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-10-12 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -160.30 106.58 2 1 LYS A 14 ? ? -37.74 144.57 3 1 THR A 71 ? ? 35.14 40.40 4 1 ALA A 77 ? ? -170.20 111.73 5 1 ALA A 78 ? ? -59.53 104.57 6 2 VAL A 63 ? ? -68.75 86.49 7 2 ASP A 64 ? ? -56.64 108.45 8 3 MET A 9 ? ? -56.12 102.05 9 3 LYS A 10 ? ? -172.73 147.39 10 3 THR A 11 ? ? -126.05 -50.73 11 3 SER A 12 ? ? -64.55 86.92 12 3 LYS A 14 ? ? -49.53 164.72 13 3 ASN A 45 ? ? -85.40 34.18 14 3 THR A 71 ? ? 35.23 46.12 15 4 LYS A 10 ? ? -82.82 44.81 16 4 SER A 12 ? ? -36.13 153.61 17 4 GLU A 58 ? ? -34.58 -33.82 18 4 LYS A 65 ? ? -39.42 156.76 19 4 VAL A 70 ? ? -39.92 135.34 20 5 MET A 31 ? ? -61.98 -72.70 21 5 ASN A 45 ? ? -90.68 30.26 22 5 LEU A 56 ? ? -91.44 -61.48 23 5 LYS A 59 ? ? -39.91 -25.74 24 6 GLN A 27 ? ? -38.01 -38.30 25 6 ASN A 45 ? ? -94.91 32.92 26 6 ASP A 72 ? ? -42.68 104.88 27 6 ALA A 77 ? ? -174.77 136.36 28 7 SER A 5 ? ? -91.45 -61.44 29 7 LYS A 14 ? ? -94.77 51.34 30 7 THR A 29 ? ? -39.33 -36.79 31 7 LYS A 43 ? ? -38.87 -39.55 32 7 ASN A 45 ? ? -86.49 34.66 33 7 LEU A 49 ? ? -91.93 -61.25 34 7 LYS A 65 ? ? -50.39 172.09 35 7 THR A 71 ? ? -130.35 -31.05 36 7 PRO A 82 ? ? -69.78 -176.36 37 8 SER A 3 ? ? -120.11 -56.40 38 8 SER A 5 ? ? -54.71 170.47 39 8 ASN A 45 ? ? -90.42 30.52 40 8 ASN A 74 ? ? 38.18 40.20 41 8 ALA A 77 ? ? -161.74 107.86 42 8 LYS A 79 ? ? -40.92 97.48 43 9 SER A 2 ? ? -67.17 99.51 44 9 GLN A 15 ? ? -131.90 -33.55 45 9 ASN A 74 ? ? -131.97 -55.72 46 9 ALA A 77 ? ? -132.48 -56.18 47 10 LYS A 59 ? ? -84.66 34.63 48 10 LYS A 60 ? ? 36.59 39.40 49 10 ASP A 64 ? ? -49.02 176.58 50 10 ALA A 77 ? ? -68.53 82.25 51 10 PRO A 82 ? ? -69.74 0.74 52 11 MET A 9 ? ? -82.39 43.19 53 11 LYS A 14 ? ? -65.90 84.73 54 11 GLU A 58 ? ? -34.83 -39.70 55 11 ASP A 64 ? ? -35.70 117.43 56 11 LEU A 68 ? ? -49.36 101.83 57 11 ALA A 77 ? ? -172.47 134.80 58 11 SER A 80 ? ? -164.41 117.44 59 12 SER A 3 ? ? -171.06 127.63 60 12 ALA A 41 ? ? -60.36 -71.22 61 12 LEU A 68 ? ? -47.60 170.99 62 12 ALA A 77 ? ? -101.28 42.57 63 12 ALA A 78 ? ? -50.46 97.06 64 12 PRO A 82 ? ? -69.80 -174.80 65 13 SER A 5 ? ? -174.44 140.62 66 13 SER A 12 ? ? -38.04 154.03 67 13 ASN A 45 ? ? -94.35 30.97 68 13 GLU A 58 ? ? -34.86 -37.37 69 13 ASP A 72 ? ? -122.05 -58.30 70 14 SER A 12 ? ? -106.28 42.00 71 14 GLN A 15 ? ? -50.54 178.78 72 14 VAL A 70 ? ? -38.38 129.79 73 14 HIS A 73 ? ? -170.36 128.34 74 15 LYS A 59 ? ? -97.14 39.52 75 15 LYS A 60 ? ? -173.55 131.70 76 16 MET A 31 ? ? -71.24 -72.80 77 16 ASN A 45 ? ? -95.75 34.78 78 16 ASN A 46 ? ? 39.84 35.45 79 16 LYS A 65 ? ? -52.98 171.44 80 16 ARG A 66 ? ? -61.53 95.60 81 16 LEU A 68 ? ? -126.00 -59.30 82 16 VAL A 70 ? ? -87.20 40.34 83 16 SER A 80 ? ? -91.49 -60.50 84 16 PRO A 82 ? ? -69.69 -173.99 85 17 THR A 29 ? ? -48.85 -19.51 86 17 ASN A 45 ? ? -98.55 37.77 87 17 ALA A 78 ? ? -174.47 125.44 88 17 PRO A 82 ? ? -69.76 99.34 89 18 SER A 2 ? ? -37.49 155.78 90 18 ASN A 45 ? ? -93.69 35.25 91 18 LYS A 59 ? ? -83.68 37.61 92 18 LYS A 60 ? ? 34.34 44.55 93 18 ASP A 62 ? ? -35.75 141.69 94 19 SER A 3 ? ? -165.19 116.94 95 19 MET A 9 ? ? -59.74 90.06 96 19 SER A 12 ? ? -101.77 -60.45 97 19 ALA A 38 ? ? -39.75 -31.17 98 19 GLU A 58 ? ? -35.15 -38.08 99 19 VAL A 70 ? ? -57.39 105.66 100 19 ASN A 74 ? ? -66.13 98.85 101 20 SER A 2 ? ? 39.90 42.27 102 20 LYS A 10 ? ? -81.51 41.28 103 20 LYS A 14 ? ? -38.60 153.21 104 20 ASN A 45 ? ? -99.99 33.73 105 20 ALA A 78 ? ? -53.90 95.92 106 20 PRO A 82 ? ? -69.72 90.78 #