data_2DKR # _entry.id 2DKR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DKR pdb_00002dkr 10.2210/pdb2dkr/pdb RCSB RCSB025531 ? ? WWPDB D_1000025531 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002012041.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DKR _pdbx_database_status.recvd_initial_deposition_date 2006-04-14 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Suetake, T.' 1 'Hayashi, F.' 2 'Yokoyama, S.' 3 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 # _citation.id primary _citation.title 'Solution structure of the PDZ domain from human Lin-7 homolog B' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Suetake, T.' 1 ? primary 'Hayashi, F.' 2 ? primary 'Yokoyama, S.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'LIN-7 homolog B' _entity.formula_weight 9480.609 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'PDZ domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'LIN-7B, hLin7B, Mammalian LIN-seven protein 2, MALS-2, Vertebrate LIN 7 homolog 2, Veli-2 protein, hVeli2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGVVELPKTDEGLGFNIMGGKEQNSPIYISRVIPGGVADRHGGLKRGDQLLSVNGVSVEGEQHEKAVELLKAAQG SVKLVVRSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGVVELPKTDEGLGFNIMGGKEQNSPIYISRVIPGGVADRHGGLKRGDQLLSVNGVSVEGEQHEKAVELLKAAQG SVKLVVRSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002012041.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 VAL n 1 9 VAL n 1 10 GLU n 1 11 LEU n 1 12 PRO n 1 13 LYS n 1 14 THR n 1 15 ASP n 1 16 GLU n 1 17 GLY n 1 18 LEU n 1 19 GLY n 1 20 PHE n 1 21 ASN n 1 22 ILE n 1 23 MET n 1 24 GLY n 1 25 GLY n 1 26 LYS n 1 27 GLU n 1 28 GLN n 1 29 ASN n 1 30 SER n 1 31 PRO n 1 32 ILE n 1 33 TYR n 1 34 ILE n 1 35 SER n 1 36 ARG n 1 37 VAL n 1 38 ILE n 1 39 PRO n 1 40 GLY n 1 41 GLY n 1 42 VAL n 1 43 ALA n 1 44 ASP n 1 45 ARG n 1 46 HIS n 1 47 GLY n 1 48 GLY n 1 49 LEU n 1 50 LYS n 1 51 ARG n 1 52 GLY n 1 53 ASP n 1 54 GLN n 1 55 LEU n 1 56 LEU n 1 57 SER n 1 58 VAL n 1 59 ASN n 1 60 GLY n 1 61 VAL n 1 62 SER n 1 63 VAL n 1 64 GLU n 1 65 GLY n 1 66 GLU n 1 67 GLN n 1 68 HIS n 1 69 GLU n 1 70 LYS n 1 71 ALA n 1 72 VAL n 1 73 GLU n 1 74 LEU n 1 75 LEU n 1 76 LYS n 1 77 ALA n 1 78 ALA n 1 79 GLN n 1 80 GLY n 1 81 SER n 1 82 VAL n 1 83 LYS n 1 84 LEU n 1 85 VAL n 1 86 VAL n 1 87 ARG n 1 88 SER n 1 89 GLY n 1 90 PRO n 1 91 SER n 1 92 SER n 1 93 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'LIN7B, MALS2, VELI2, UNQ3116/PRO10200' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cell free synthesis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050516-07 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LIN7B_HUMAN _struct_ref.pdbx_db_accession Q9HAP6 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 93 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DKR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 87 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9HAP6 _struct_ref_seq.db_align_beg 93 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 172 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 87 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DKR GLY A 1 ? UNP Q9HAP6 ? ? 'cloning artifact' 1 1 1 2DKR SER A 2 ? UNP Q9HAP6 ? ? 'cloning artifact' 2 2 1 2DKR SER A 3 ? UNP Q9HAP6 ? ? 'cloning artifact' 3 3 1 2DKR GLY A 4 ? UNP Q9HAP6 ? ? 'cloning artifact' 4 4 1 2DKR SER A 5 ? UNP Q9HAP6 ? ? 'cloning artifact' 5 5 1 2DKR SER A 6 ? UNP Q9HAP6 ? ? 'cloning artifact' 6 6 1 2DKR GLY A 7 ? UNP Q9HAP6 ? ? 'cloning artifact' 7 7 1 2DKR SER A 88 ? UNP Q9HAP6 ? ? 'cloning artifact' 88 8 1 2DKR GLY A 89 ? UNP Q9HAP6 ? ? 'cloning artifact' 89 9 1 2DKR PRO A 90 ? UNP Q9HAP6 ? ? 'cloning artifact' 90 10 1 2DKR SER A 91 ? UNP Q9HAP6 ? ? 'cloning artifact' 91 11 1 2DKR SER A 92 ? UNP Q9HAP6 ? ? 'cloning artifact' 92 12 1 2DKR GLY A 93 ? UNP Q9HAP6 ? ? 'cloning artifact' 93 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.12mM 13C, 15N-labeled protein; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3, 90% H2O; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2DKR _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2DKR _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violation, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DKR _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C VARIAN 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B. A.' 3 'data analysis' KUJIRA 0.9321 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2DKR _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2DKR _struct.title 'Solution structure of the PDZ domain from human Lin-7 homolog B' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DKR _struct_keywords.pdbx_keywords 'PROTEIN TRANSPORT' _struct_keywords.text ;Lin-7b, PDZ, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN TRANSPORT ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 41 ? GLY A 47 ? GLY A 41 GLY A 47 1 ? 7 HELX_P HELX_P2 2 GLN A 67 ? ALA A 78 ? GLN A 67 ALA A 78 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 8 ? PRO A 12 ? VAL A 8 PRO A 12 A 2 SER A 81 ? VAL A 86 ? SER A 81 VAL A 86 A 3 LEU A 55 ? VAL A 58 ? LEU A 55 VAL A 58 A 4 VAL A 61 ? SER A 62 ? VAL A 61 SER A 62 B 1 PHE A 20 ? MET A 23 ? PHE A 20 MET A 23 B 2 TYR A 33 ? VAL A 37 ? TYR A 33 VAL A 37 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 9 ? N VAL A 9 O LEU A 84 ? O LEU A 84 A 2 3 O VAL A 85 ? O VAL A 85 N SER A 57 ? N SER A 57 A 3 4 N VAL A 58 ? N VAL A 58 O VAL A 61 ? O VAL A 61 B 1 2 N ASN A 21 ? N ASN A 21 O ARG A 36 ? O ARG A 36 # _database_PDB_matrix.entry_id 2DKR _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DKR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 GLY 93 93 93 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-10-14 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 39 ? ? -69.72 3.93 2 1 ALA A 78 ? ? -54.27 170.39 3 2 PRO A 39 ? ? -69.76 6.35 4 2 ALA A 78 ? ? -53.48 170.17 5 3 ASP A 15 ? ? -39.29 -39.64 6 3 LYS A 26 ? ? -90.23 -63.94 7 3 PRO A 39 ? ? -69.68 3.16 8 4 PRO A 39 ? ? -69.76 7.00 9 5 ASP A 15 ? ? -36.92 -33.56 10 5 PRO A 39 ? ? -69.75 6.58 11 5 ASP A 53 ? ? -52.27 107.57 12 5 SER A 62 ? ? -55.07 106.14 13 5 GLN A 67 ? ? -52.37 175.61 14 6 ASP A 15 ? ? -36.94 -38.17 15 6 PRO A 39 ? ? -69.74 2.98 16 6 GLU A 64 ? ? -39.06 -38.87 17 6 PRO A 90 ? ? -69.71 2.24 18 7 ASP A 15 ? ? -37.22 -39.51 19 7 ASN A 29 ? ? -56.10 102.12 20 7 PRO A 39 ? ? -69.78 3.67 21 7 GLU A 64 ? ? -54.99 101.97 22 8 SER A 6 ? ? -52.16 173.75 23 8 PRO A 39 ? ? -69.70 6.25 24 9 ASP A 15 ? ? -38.81 -38.18 25 9 LYS A 26 ? ? -92.06 -67.44 26 9 PRO A 39 ? ? -69.72 4.63 27 9 GLU A 64 ? ? -38.70 -34.66 28 9 ALA A 78 ? ? -59.42 178.17 29 10 ASP A 15 ? ? -39.32 -36.54 30 10 LYS A 26 ? ? -93.23 -60.71 31 10 PRO A 39 ? ? -69.78 2.86 32 10 ASP A 53 ? ? -55.34 108.13 33 10 ALA A 78 ? ? -55.87 171.19 34 11 ASN A 29 ? ? -52.10 103.12 35 11 PRO A 90 ? ? -69.74 87.83 36 12 ASP A 15 ? ? -38.95 -33.23 37 12 LEU A 18 ? ? -97.96 -65.75 38 12 LYS A 26 ? ? -93.64 -62.26 39 12 PRO A 39 ? ? -69.77 4.55 40 12 ASP A 53 ? ? -52.05 108.51 41 13 ASP A 15 ? ? -34.43 -38.15 42 13 LYS A 26 ? ? -95.51 -65.58 43 13 PRO A 39 ? ? -69.72 3.69 44 14 ASP A 15 ? ? -38.62 -32.43 45 14 GLU A 16 ? ? -34.32 -36.37 46 14 LYS A 26 ? ? -90.83 -65.69 47 14 PRO A 39 ? ? -69.77 3.13 48 15 LEU A 18 ? ? -97.53 -61.08 49 15 PRO A 39 ? ? -69.72 5.12 50 15 ALA A 78 ? ? -55.90 170.36 51 16 PRO A 39 ? ? -69.75 2.96 52 16 PRO A 90 ? ? -69.76 85.23 53 17 GLU A 16 ? ? -39.65 -39.35 54 17 PRO A 39 ? ? -69.73 3.28 55 17 LEU A 55 ? ? -55.73 107.73 56 17 GLU A 64 ? ? -54.05 103.27 57 17 PRO A 90 ? ? -69.76 2.53 58 17 SER A 91 ? ? -52.03 171.56 59 18 PRO A 39 ? ? -69.75 2.92 60 18 ASP A 53 ? ? -52.40 105.59 61 18 GLU A 64 ? ? -36.74 -34.39 62 18 ALA A 78 ? ? -54.92 174.17 63 19 ASP A 15 ? ? -37.85 -34.81 64 19 PRO A 39 ? ? -69.79 3.20 65 19 ALA A 78 ? ? -56.37 170.18 66 20 PRO A 39 ? ? -69.77 3.23 #