data_2DL4 # _entry.id 2DL4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DL4 pdb_00002dl4 10.2210/pdb2dl4/pdb RCSB RCSB025543 ? ? WWPDB D_1000025543 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-10-17 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DL4 _pdbx_database_status.recvd_initial_deposition_date 2006-04-17 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002013291.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Qin, X.R.' 1 'Suetake, T.' 2 'Hayashi, F.' 3 'Yokoyama, S.' 4 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 # _citation.id primary _citation.title 'Solution structure of the first SH3 domain of Stac protein' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Qin, X.R.' 1 ? primary 'Suetake, T.' 2 ? primary 'Hayashi, F.' 3 ? primary 'Yokoyama, S.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Protein Stac' _entity.formula_weight 7559.270 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SH3 domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'SRC homology 3 and cysteine-rich domain protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGNTYVALYKFVPQENEDLEMRPGDIITLLEDSNEDWWKGKIQDRIGFFPANFVQRLSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGNTYVALYKFVPQENEDLEMRPGDIITLLEDSNEDWWKGKIQDRIGFFPANFVQRLSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002013291.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 ASN n 1 9 THR n 1 10 TYR n 1 11 VAL n 1 12 ALA n 1 13 LEU n 1 14 TYR n 1 15 LYS n 1 16 PHE n 1 17 VAL n 1 18 PRO n 1 19 GLN n 1 20 GLU n 1 21 ASN n 1 22 GLU n 1 23 ASP n 1 24 LEU n 1 25 GLU n 1 26 MET n 1 27 ARG n 1 28 PRO n 1 29 GLY n 1 30 ASP n 1 31 ILE n 1 32 ILE n 1 33 THR n 1 34 LEU n 1 35 LEU n 1 36 GLU n 1 37 ASP n 1 38 SER n 1 39 ASN n 1 40 GLU n 1 41 ASP n 1 42 TRP n 1 43 TRP n 1 44 LYS n 1 45 GLY n 1 46 LYS n 1 47 ILE n 1 48 GLN n 1 49 ASP n 1 50 ARG n 1 51 ILE n 1 52 GLY n 1 53 PHE n 1 54 PHE n 1 55 PRO n 1 56 ALA n 1 57 ASN n 1 58 PHE n 1 59 VAL n 1 60 GLN n 1 61 ARG n 1 62 LEU n 1 63 SER n 1 64 GLY n 1 65 PRO n 1 66 SER n 1 67 SER n 1 68 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene STAC _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cell free synthesis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050613-10 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 TRP 42 42 42 TRP TRP A . n A 1 43 TRP 43 43 43 TRP TRP A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 GLY 68 68 68 GLY GLY A . n # _exptl.entry_id 2DL4 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2DL4 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2DL4 _struct.title 'Solution structure of the first SH3 domain of Stac protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DL4 _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text ;SH3 domain, Stac protein, SRC homology 3, cysteine-rich domain protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code STAC_HUMAN _struct_ref.pdbx_db_accession Q99469 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 288 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DL4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 62 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q99469 _struct_ref_seq.db_align_beg 288 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 342 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 62 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DL4 GLY A 1 ? UNP Q99469 ? ? 'cloning artifact' 1 1 1 2DL4 SER A 2 ? UNP Q99469 ? ? 'cloning artifact' 2 2 1 2DL4 SER A 3 ? UNP Q99469 ? ? 'cloning artifact' 3 3 1 2DL4 GLY A 4 ? UNP Q99469 ? ? 'cloning artifact' 4 4 1 2DL4 SER A 5 ? UNP Q99469 ? ? 'cloning artifact' 5 5 1 2DL4 SER A 6 ? UNP Q99469 ? ? 'cloning artifact' 6 6 1 2DL4 GLY A 7 ? UNP Q99469 ? ? 'cloning artifact' 7 7 1 2DL4 SER A 63 ? UNP Q99469 ? ? 'cloning artifact' 63 8 1 2DL4 GLY A 64 ? UNP Q99469 ? ? 'cloning artifact' 64 9 1 2DL4 PRO A 65 ? UNP Q99469 ? ? 'cloning artifact' 65 10 1 2DL4 SER A 66 ? UNP Q99469 ? ? 'cloning artifact' 66 11 1 2DL4 SER A 67 ? UNP Q99469 ? ? 'cloning artifact' 67 12 1 2DL4 GLY A 68 ? UNP Q99469 ? ? 'cloning artifact' 68 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 51 ? PRO A 55 ? ILE A 51 PRO A 55 A 2 TRP A 42 ? LYS A 46 ? TRP A 42 LYS A 46 A 3 ILE A 31 ? GLU A 36 ? ILE A 31 GLU A 36 A 4 THR A 9 ? ALA A 12 ? THR A 9 ALA A 12 A 5 VAL A 59 ? ARG A 61 ? VAL A 59 ARG A 61 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O PHE A 54 ? O PHE A 54 N TRP A 43 ? N TRP A 43 A 2 3 O LYS A 44 ? O LYS A 44 N GLU A 36 ? N GLU A 36 A 3 4 O ILE A 32 ? O ILE A 32 N TYR A 10 ? N TYR A 10 A 4 5 N VAL A 11 ? N VAL A 11 O GLN A 60 ? O GLN A 60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 28 ? ? -69.72 95.89 2 1 GLN A 48 ? ? -33.59 -75.04 3 1 ARG A 61 ? ? -37.79 130.24 4 1 PRO A 65 ? ? -69.74 99.76 5 2 PRO A 28 ? ? -69.85 90.00 6 2 GLN A 48 ? ? -33.65 -70.54 7 3 SER A 5 ? ? 35.30 34.72 8 3 PRO A 28 ? ? -69.74 90.85 9 3 GLN A 48 ? ? -34.35 -71.96 10 4 PRO A 28 ? ? -69.81 99.32 11 4 GLN A 48 ? ? -32.36 -72.61 12 4 ARG A 61 ? ? -35.65 136.52 13 4 PRO A 65 ? ? -69.74 86.85 14 5 PRO A 28 ? ? -69.75 92.24 15 5 GLN A 48 ? ? -34.18 -71.60 16 5 PRO A 65 ? ? -69.74 93.25 17 6 SER A 2 ? ? -61.60 99.76 18 6 SER A 3 ? ? 39.00 42.61 19 6 PRO A 28 ? ? -69.77 96.07 20 6 ASP A 41 ? ? -72.93 -70.19 21 6 GLN A 48 ? ? -34.07 -73.68 22 7 PRO A 28 ? ? -69.80 89.62 23 7 LEU A 34 ? ? -58.11 109.97 24 7 ARG A 61 ? ? -37.26 135.37 25 7 SER A 66 ? ? -128.47 -51.42 26 7 SER A 67 ? ? -43.15 158.99 27 8 PRO A 28 ? ? -69.82 88.57 28 8 ASN A 39 ? ? -110.87 79.73 29 8 GLN A 48 ? ? -31.15 -75.07 30 9 SER A 5 ? ? -52.21 103.29 31 9 ASN A 21 ? ? -84.52 31.54 32 9 PRO A 28 ? ? -69.76 92.69 33 9 GLN A 48 ? ? -34.27 -74.98 34 9 PRO A 65 ? ? -69.85 1.58 35 10 SER A 2 ? ? -42.10 109.48 36 10 PRO A 28 ? ? -69.70 84.48 37 10 GLN A 48 ? ? -31.04 -75.14 38 11 PRO A 28 ? ? -69.75 86.85 39 11 GLN A 48 ? ? -30.51 -71.39 40 12 LEU A 34 ? ? -59.38 109.80 41 12 GLN A 48 ? ? -33.18 -74.79 42 13 PRO A 28 ? ? -69.78 95.51 43 13 LEU A 34 ? ? -57.80 103.12 44 13 GLN A 48 ? ? -29.93 -73.65 45 14 SER A 6 ? ? -91.77 42.20 46 14 PRO A 28 ? ? -69.76 88.98 47 14 ASP A 41 ? ? -58.02 -70.35 48 14 GLN A 48 ? ? -29.04 -74.80 49 14 SER A 66 ? ? -68.98 94.77 50 15 SER A 5 ? ? 34.51 41.93 51 15 GLN A 48 ? ? -33.54 -74.01 52 15 PRO A 65 ? ? -69.77 -178.49 53 16 PRO A 28 ? ? -69.73 93.78 54 16 ASN A 39 ? ? -55.35 -175.01 55 16 GLN A 48 ? ? -28.34 -68.80 56 16 ARG A 61 ? ? -37.02 138.12 57 16 PRO A 65 ? ? -69.80 2.73 58 16 SER A 66 ? ? -36.54 123.17 59 16 SER A 67 ? ? -38.33 -30.64 60 17 ASN A 21 ? ? -87.20 33.71 61 17 PRO A 28 ? ? -69.76 88.12 62 18 SER A 3 ? ? -126.42 -53.93 63 18 LEU A 35 ? ? -98.44 -61.05 64 18 GLN A 48 ? ? -32.04 -74.26 65 18 ARG A 61 ? ? -39.04 133.18 66 19 SER A 3 ? ? -69.28 97.80 67 19 PRO A 28 ? ? -69.82 95.38 68 19 GLN A 48 ? ? -33.61 -73.31 69 19 PRO A 65 ? ? -69.77 96.76 70 20 SER A 5 ? ? -45.39 156.96 71 20 ASN A 21 ? ? -83.79 34.38 72 20 PRO A 28 ? ? -69.69 93.12 73 20 GLU A 40 ? ? -122.78 -57.11 74 20 ASP A 41 ? ? -58.34 -71.37 75 20 GLN A 48 ? ? -30.19 -72.31 76 20 LEU A 62 ? ? -102.01 40.35 77 20 PRO A 65 ? ? -69.81 93.73 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 2DL4 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DL4 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1.09mM 13C, 15N-labeled protein; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_refine.entry_id 2DL4 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9296 Kobayashi,N. 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 ILE N N N N 123 ILE CA C N S 124 ILE C C N N 125 ILE O O N N 126 ILE CB C N S 127 ILE CG1 C N N 128 ILE CG2 C N N 129 ILE CD1 C N N 130 ILE OXT O N N 131 ILE H H N N 132 ILE H2 H N N 133 ILE HA H N N 134 ILE HB H N N 135 ILE HG12 H N N 136 ILE HG13 H N N 137 ILE HG21 H N N 138 ILE HG22 H N N 139 ILE HG23 H N N 140 ILE HD11 H N N 141 ILE HD12 H N N 142 ILE HD13 H N N 143 ILE HXT H N N 144 LEU N N N N 145 LEU CA C N S 146 LEU C C N N 147 LEU O O N N 148 LEU CB C N N 149 LEU CG C N N 150 LEU CD1 C N N 151 LEU CD2 C N N 152 LEU OXT O N N 153 LEU H H N N 154 LEU H2 H N N 155 LEU HA H N N 156 LEU HB2 H N N 157 LEU HB3 H N N 158 LEU HG H N N 159 LEU HD11 H N N 160 LEU HD12 H N N 161 LEU HD13 H N N 162 LEU HD21 H N N 163 LEU HD22 H N N 164 LEU HD23 H N N 165 LEU HXT H N N 166 LYS N N N N 167 LYS CA C N S 168 LYS C C N N 169 LYS O O N N 170 LYS CB C N N 171 LYS CG C N N 172 LYS CD C N N 173 LYS CE C N N 174 LYS NZ N N N 175 LYS OXT O N N 176 LYS H H N N 177 LYS H2 H N N 178 LYS HA H N N 179 LYS HB2 H N N 180 LYS HB3 H N N 181 LYS HG2 H N N 182 LYS HG3 H N N 183 LYS HD2 H N N 184 LYS HD3 H N N 185 LYS HE2 H N N 186 LYS HE3 H N N 187 LYS HZ1 H N N 188 LYS HZ2 H N N 189 LYS HZ3 H N N 190 LYS HXT H N N 191 MET N N N N 192 MET CA C N S 193 MET C C N N 194 MET O O N N 195 MET CB C N N 196 MET CG C N N 197 MET SD S N N 198 MET CE C N N 199 MET OXT O N N 200 MET H H N N 201 MET H2 H N N 202 MET HA H N N 203 MET HB2 H N N 204 MET HB3 H N N 205 MET HG2 H N N 206 MET HG3 H N N 207 MET HE1 H N N 208 MET HE2 H N N 209 MET HE3 H N N 210 MET HXT H N N 211 PHE N N N N 212 PHE CA C N S 213 PHE C C N N 214 PHE O O N N 215 PHE CB C N N 216 PHE CG C Y N 217 PHE CD1 C Y N 218 PHE CD2 C Y N 219 PHE CE1 C Y N 220 PHE CE2 C Y N 221 PHE CZ C Y N 222 PHE OXT O N N 223 PHE H H N N 224 PHE H2 H N N 225 PHE HA H N N 226 PHE HB2 H N N 227 PHE HB3 H N N 228 PHE HD1 H N N 229 PHE HD2 H N N 230 PHE HE1 H N N 231 PHE HE2 H N N 232 PHE HZ H N N 233 PHE HXT H N N 234 PRO N N N N 235 PRO CA C N S 236 PRO C C N N 237 PRO O O N N 238 PRO CB C N N 239 PRO CG C N N 240 PRO CD C N N 241 PRO OXT O N N 242 PRO H H N N 243 PRO HA H N N 244 PRO HB2 H N N 245 PRO HB3 H N N 246 PRO HG2 H N N 247 PRO HG3 H N N 248 PRO HD2 H N N 249 PRO HD3 H N N 250 PRO HXT H N N 251 SER N N N N 252 SER CA C N S 253 SER C C N N 254 SER O O N N 255 SER CB C N N 256 SER OG O N N 257 SER OXT O N N 258 SER H H N N 259 SER H2 H N N 260 SER HA H N N 261 SER HB2 H N N 262 SER HB3 H N N 263 SER HG H N N 264 SER HXT H N N 265 THR N N N N 266 THR CA C N S 267 THR C C N N 268 THR O O N N 269 THR CB C N R 270 THR OG1 O N N 271 THR CG2 C N N 272 THR OXT O N N 273 THR H H N N 274 THR H2 H N N 275 THR HA H N N 276 THR HB H N N 277 THR HG1 H N N 278 THR HG21 H N N 279 THR HG22 H N N 280 THR HG23 H N N 281 THR HXT H N N 282 TRP N N N N 283 TRP CA C N S 284 TRP C C N N 285 TRP O O N N 286 TRP CB C N N 287 TRP CG C Y N 288 TRP CD1 C Y N 289 TRP CD2 C Y N 290 TRP NE1 N Y N 291 TRP CE2 C Y N 292 TRP CE3 C Y N 293 TRP CZ2 C Y N 294 TRP CZ3 C Y N 295 TRP CH2 C Y N 296 TRP OXT O N N 297 TRP H H N N 298 TRP H2 H N N 299 TRP HA H N N 300 TRP HB2 H N N 301 TRP HB3 H N N 302 TRP HD1 H N N 303 TRP HE1 H N N 304 TRP HE3 H N N 305 TRP HZ2 H N N 306 TRP HZ3 H N N 307 TRP HH2 H N N 308 TRP HXT H N N 309 TYR N N N N 310 TYR CA C N S 311 TYR C C N N 312 TYR O O N N 313 TYR CB C N N 314 TYR CG C Y N 315 TYR CD1 C Y N 316 TYR CD2 C Y N 317 TYR CE1 C Y N 318 TYR CE2 C Y N 319 TYR CZ C Y N 320 TYR OH O N N 321 TYR OXT O N N 322 TYR H H N N 323 TYR H2 H N N 324 TYR HA H N N 325 TYR HB2 H N N 326 TYR HB3 H N N 327 TYR HD1 H N N 328 TYR HD2 H N N 329 TYR HE1 H N N 330 TYR HE2 H N N 331 TYR HH H N N 332 TYR HXT H N N 333 VAL N N N N 334 VAL CA C N S 335 VAL C C N N 336 VAL O O N N 337 VAL CB C N N 338 VAL CG1 C N N 339 VAL CG2 C N N 340 VAL OXT O N N 341 VAL H H N N 342 VAL H2 H N N 343 VAL HA H N N 344 VAL HB H N N 345 VAL HG11 H N N 346 VAL HG12 H N N 347 VAL HG13 H N N 348 VAL HG21 H N N 349 VAL HG22 H N N 350 VAL HG23 H N N 351 VAL HXT H N N 352 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 ILE N CA sing N N 116 ILE N H sing N N 117 ILE N H2 sing N N 118 ILE CA C sing N N 119 ILE CA CB sing N N 120 ILE CA HA sing N N 121 ILE C O doub N N 122 ILE C OXT sing N N 123 ILE CB CG1 sing N N 124 ILE CB CG2 sing N N 125 ILE CB HB sing N N 126 ILE CG1 CD1 sing N N 127 ILE CG1 HG12 sing N N 128 ILE CG1 HG13 sing N N 129 ILE CG2 HG21 sing N N 130 ILE CG2 HG22 sing N N 131 ILE CG2 HG23 sing N N 132 ILE CD1 HD11 sing N N 133 ILE CD1 HD12 sing N N 134 ILE CD1 HD13 sing N N 135 ILE OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 MET N CA sing N N 182 MET N H sing N N 183 MET N H2 sing N N 184 MET CA C sing N N 185 MET CA CB sing N N 186 MET CA HA sing N N 187 MET C O doub N N 188 MET C OXT sing N N 189 MET CB CG sing N N 190 MET CB HB2 sing N N 191 MET CB HB3 sing N N 192 MET CG SD sing N N 193 MET CG HG2 sing N N 194 MET CG HG3 sing N N 195 MET SD CE sing N N 196 MET CE HE1 sing N N 197 MET CE HE2 sing N N 198 MET CE HE3 sing N N 199 MET OXT HXT sing N N 200 PHE N CA sing N N 201 PHE N H sing N N 202 PHE N H2 sing N N 203 PHE CA C sing N N 204 PHE CA CB sing N N 205 PHE CA HA sing N N 206 PHE C O doub N N 207 PHE C OXT sing N N 208 PHE CB CG sing N N 209 PHE CB HB2 sing N N 210 PHE CB HB3 sing N N 211 PHE CG CD1 doub Y N 212 PHE CG CD2 sing Y N 213 PHE CD1 CE1 sing Y N 214 PHE CD1 HD1 sing N N 215 PHE CD2 CE2 doub Y N 216 PHE CD2 HD2 sing N N 217 PHE CE1 CZ doub Y N 218 PHE CE1 HE1 sing N N 219 PHE CE2 CZ sing Y N 220 PHE CE2 HE2 sing N N 221 PHE CZ HZ sing N N 222 PHE OXT HXT sing N N 223 PRO N CA sing N N 224 PRO N CD sing N N 225 PRO N H sing N N 226 PRO CA C sing N N 227 PRO CA CB sing N N 228 PRO CA HA sing N N 229 PRO C O doub N N 230 PRO C OXT sing N N 231 PRO CB CG sing N N 232 PRO CB HB2 sing N N 233 PRO CB HB3 sing N N 234 PRO CG CD sing N N 235 PRO CG HG2 sing N N 236 PRO CG HG3 sing N N 237 PRO CD HD2 sing N N 238 PRO CD HD3 sing N N 239 PRO OXT HXT sing N N 240 SER N CA sing N N 241 SER N H sing N N 242 SER N H2 sing N N 243 SER CA C sing N N 244 SER CA CB sing N N 245 SER CA HA sing N N 246 SER C O doub N N 247 SER C OXT sing N N 248 SER CB OG sing N N 249 SER CB HB2 sing N N 250 SER CB HB3 sing N N 251 SER OG HG sing N N 252 SER OXT HXT sing N N 253 THR N CA sing N N 254 THR N H sing N N 255 THR N H2 sing N N 256 THR CA C sing N N 257 THR CA CB sing N N 258 THR CA HA sing N N 259 THR C O doub N N 260 THR C OXT sing N N 261 THR CB OG1 sing N N 262 THR CB CG2 sing N N 263 THR CB HB sing N N 264 THR OG1 HG1 sing N N 265 THR CG2 HG21 sing N N 266 THR CG2 HG22 sing N N 267 THR CG2 HG23 sing N N 268 THR OXT HXT sing N N 269 TRP N CA sing N N 270 TRP N H sing N N 271 TRP N H2 sing N N 272 TRP CA C sing N N 273 TRP CA CB sing N N 274 TRP CA HA sing N N 275 TRP C O doub N N 276 TRP C OXT sing N N 277 TRP CB CG sing N N 278 TRP CB HB2 sing N N 279 TRP CB HB3 sing N N 280 TRP CG CD1 doub Y N 281 TRP CG CD2 sing Y N 282 TRP CD1 NE1 sing Y N 283 TRP CD1 HD1 sing N N 284 TRP CD2 CE2 doub Y N 285 TRP CD2 CE3 sing Y N 286 TRP NE1 CE2 sing Y N 287 TRP NE1 HE1 sing N N 288 TRP CE2 CZ2 sing Y N 289 TRP CE3 CZ3 doub Y N 290 TRP CE3 HE3 sing N N 291 TRP CZ2 CH2 doub Y N 292 TRP CZ2 HZ2 sing N N 293 TRP CZ3 CH2 sing Y N 294 TRP CZ3 HZ3 sing N N 295 TRP CH2 HH2 sing N N 296 TRP OXT HXT sing N N 297 TYR N CA sing N N 298 TYR N H sing N N 299 TYR N H2 sing N N 300 TYR CA C sing N N 301 TYR CA CB sing N N 302 TYR CA HA sing N N 303 TYR C O doub N N 304 TYR C OXT sing N N 305 TYR CB CG sing N N 306 TYR CB HB2 sing N N 307 TYR CB HB3 sing N N 308 TYR CG CD1 doub Y N 309 TYR CG CD2 sing Y N 310 TYR CD1 CE1 sing Y N 311 TYR CD1 HD1 sing N N 312 TYR CD2 CE2 doub Y N 313 TYR CD2 HD2 sing N N 314 TYR CE1 CZ doub Y N 315 TYR CE1 HE1 sing N N 316 TYR CE2 CZ sing Y N 317 TYR CE2 HE2 sing N N 318 TYR CZ OH sing N N 319 TYR OH HH sing N N 320 TYR OXT HXT sing N N 321 VAL N CA sing N N 322 VAL N H sing N N 323 VAL N H2 sing N N 324 VAL CA C sing N N 325 VAL CA CB sing N N 326 VAL CA HA sing N N 327 VAL C O doub N N 328 VAL C OXT sing N N 329 VAL CB CG1 sing N N 330 VAL CB CG2 sing N N 331 VAL CB HB sing N N 332 VAL CG1 HG11 sing N N 333 VAL CG1 HG12 sing N N 334 VAL CG1 HG13 sing N N 335 VAL CG2 HG21 sing N N 336 VAL CG2 HG22 sing N N 337 VAL CG2 HG23 sing N N 338 VAL OXT HXT sing N N 339 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2DL4 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_