data_2DL5 # _entry.id 2DL5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DL5 pdb_00002dl5 10.2210/pdb2dl5/pdb RCSB RCSB025544 ? ? WWPDB D_1000025544 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2DL7 'same protein' unspecified TargetDB hsk002100751.2 . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DL5 _pdbx_database_status.recvd_initial_deposition_date 2006-04-17 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Qin, X.R.' 1 'Izumi, K.' 2 'Yoshida, M.' 3 'Hayashi, F.' 4 'Yokoyama, S.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title 'Solution structure of the first SH3 domain of human KIAA0769 protein' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Qin, X.R.' 1 ? primary 'Izumi, K.' 2 ? primary 'Yoshida, M.' 3 ? primary 'Hayashi, F.' 4 ? primary 'Yokoyama, S.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'KIAA0769 protein' _entity.formula_weight 8550.381 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SH3 domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGTLRNYPLTCKVVYSYKASQPDELTIEEHEVLEVIEDGDMEDWVKARNKVGQVGYVPEKYLQFPTSSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGTLRNYPLTCKVVYSYKASQPDELTIEEHEVLEVIEDGDMEDWVKARNKVGQVGYVPEKYLQFPTSSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk002100751.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 THR n 1 9 LEU n 1 10 ARG n 1 11 ASN n 1 12 TYR n 1 13 PRO n 1 14 LEU n 1 15 THR n 1 16 CYS n 1 17 LYS n 1 18 VAL n 1 19 VAL n 1 20 TYR n 1 21 SER n 1 22 TYR n 1 23 LYS n 1 24 ALA n 1 25 SER n 1 26 GLN n 1 27 PRO n 1 28 ASP n 1 29 GLU n 1 30 LEU n 1 31 THR n 1 32 ILE n 1 33 GLU n 1 34 GLU n 1 35 HIS n 1 36 GLU n 1 37 VAL n 1 38 LEU n 1 39 GLU n 1 40 VAL n 1 41 ILE n 1 42 GLU n 1 43 ASP n 1 44 GLY n 1 45 ASP n 1 46 MET n 1 47 GLU n 1 48 ASP n 1 49 TRP n 1 50 VAL n 1 51 LYS n 1 52 ALA n 1 53 ARG n 1 54 ASN n 1 55 LYS n 1 56 VAL n 1 57 GLY n 1 58 GLN n 1 59 VAL n 1 60 GLY n 1 61 TYR n 1 62 VAL n 1 63 PRO n 1 64 GLU n 1 65 LYS n 1 66 TYR n 1 67 LEU n 1 68 GLN n 1 69 PHE n 1 70 PRO n 1 71 THR n 1 72 SER n 1 73 SER n 1 74 GLY n 1 75 PRO n 1 76 SER n 1 77 SER n 1 78 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'FCHSD2, KIAA0769' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cell free synthesis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050725-11 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8WVM2_HUMAN _struct_ref.pdbx_db_accession Q8WVM2 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 54 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DL5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 72 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8WVM2 _struct_ref_seq.db_align_beg 54 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 120 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 72 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DL5 GLY A 1 ? UNP Q8WVM2 ? ? 'cloning artifact' 1 1 1 2DL5 SER A 2 ? UNP Q8WVM2 ? ? 'cloning artifact' 2 2 1 2DL5 SER A 3 ? UNP Q8WVM2 ? ? 'cloning artifact' 3 3 1 2DL5 GLY A 4 ? UNP Q8WVM2 ? ? 'cloning artifact' 4 4 1 2DL5 SER A 5 ? UNP Q8WVM2 ? ? 'cloning artifact' 5 5 1 2DL5 SER A 6 ? UNP Q8WVM2 ? ? 'cloning artifact' 6 6 1 2DL5 GLY A 7 ? UNP Q8WVM2 ? ? 'cloning artifact' 7 7 1 2DL5 SER A 73 ? UNP Q8WVM2 ? ? 'cloning artifact' 73 8 1 2DL5 GLY A 74 ? UNP Q8WVM2 ? ? 'cloning artifact' 74 9 1 2DL5 PRO A 75 ? UNP Q8WVM2 ? ? 'cloning artifact' 75 10 1 2DL5 SER A 76 ? UNP Q8WVM2 ? ? 'cloning artifact' 76 11 1 2DL5 SER A 77 ? UNP Q8WVM2 ? ? 'cloning artifact' 77 12 1 2DL5 GLY A 78 ? UNP Q8WVM2 ? ? 'cloning artifact' 78 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.18mM 13C,15N-labeled protein; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model ECA _pdbx_nmr_spectrometer.manufacturer JEOL _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2DL5 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2DL5 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DL5 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection Delta 4.3 JEOL 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9296 Kobayashi,N 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2DL5 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2DL5 _struct.title 'Solution structure of the first SH3 domain of human KIAA0769 protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DL5 _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;SH3 domain, KIAA0769, FCHSD2, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 12 A . ? TYR 12 A PRO 13 A ? PRO 13 A 1 -0.13 2 TYR 12 A . ? TYR 12 A PRO 13 A ? PRO 13 A 2 -0.02 3 TYR 12 A . ? TYR 12 A PRO 13 A ? PRO 13 A 3 -0.07 4 TYR 12 A . ? TYR 12 A PRO 13 A ? PRO 13 A 4 -0.06 5 TYR 12 A . ? TYR 12 A PRO 13 A ? PRO 13 A 5 -0.08 6 TYR 12 A . ? TYR 12 A PRO 13 A ? PRO 13 A 6 -0.09 7 TYR 12 A . ? TYR 12 A PRO 13 A ? PRO 13 A 7 -0.01 8 TYR 12 A . ? TYR 12 A PRO 13 A ? PRO 13 A 8 -0.02 9 TYR 12 A . ? TYR 12 A PRO 13 A ? PRO 13 A 9 -0.08 10 TYR 12 A . ? TYR 12 A PRO 13 A ? PRO 13 A 10 0.02 11 TYR 12 A . ? TYR 12 A PRO 13 A ? PRO 13 A 11 -0.02 12 TYR 12 A . ? TYR 12 A PRO 13 A ? PRO 13 A 12 -0.10 13 TYR 12 A . ? TYR 12 A PRO 13 A ? PRO 13 A 13 -0.08 14 TYR 12 A . ? TYR 12 A PRO 13 A ? PRO 13 A 14 -0.01 15 TYR 12 A . ? TYR 12 A PRO 13 A ? PRO 13 A 15 -0.06 16 TYR 12 A . ? TYR 12 A PRO 13 A ? PRO 13 A 16 -0.03 17 TYR 12 A . ? TYR 12 A PRO 13 A ? PRO 13 A 17 -0.07 18 TYR 12 A . ? TYR 12 A PRO 13 A ? PRO 13 A 18 -0.08 19 TYR 12 A . ? TYR 12 A PRO 13 A ? PRO 13 A 19 -0.02 20 TYR 12 A . ? TYR 12 A PRO 13 A ? PRO 13 A 20 -0.06 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 14 ? VAL A 18 ? LEU A 14 VAL A 18 A 2 GLU A 36 ? GLU A 42 ? GLU A 36 GLU A 42 A 3 TRP A 49 ? ARG A 53 ? TRP A 49 ARG A 53 A 4 VAL A 59 ? PRO A 63 ? VAL A 59 PRO A 63 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 14 ? N LEU A 14 O VAL A 40 ? O VAL A 40 A 2 3 N GLU A 42 ? N GLU A 42 O LYS A 51 ? O LYS A 51 A 3 4 N VAL A 50 ? N VAL A 50 O VAL A 62 ? O VAL A 62 # _database_PDB_matrix.entry_id 2DL5 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DL5 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 TRP 49 49 49 TRP TRP A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 GLY 78 78 78 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-10-17 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 3 ? ? 36.00 39.61 2 1 SER A 6 ? ? -130.50 -43.40 3 1 ASN A 11 ? ? 39.42 41.32 4 1 THR A 71 ? ? -53.74 90.86 5 2 SER A 21 ? ? -45.92 158.00 6 2 PRO A 27 ? ? -69.78 1.79 7 2 THR A 71 ? ? -42.43 150.79 8 2 SER A 72 ? ? -42.98 160.87 9 2 SER A 77 ? ? -41.00 100.62 10 3 ARG A 10 ? ? -51.80 171.58 11 3 TYR A 12 ? ? -46.42 154.48 12 3 GLU A 34 ? ? -37.61 143.35 13 3 ASP A 43 ? ? -94.95 43.05 14 4 ASN A 11 ? ? -112.90 56.34 15 4 GLU A 34 ? ? -41.76 161.77 16 4 ASP A 43 ? ? -90.79 48.34 17 4 ASP A 48 ? ? -106.82 42.78 18 4 PRO A 70 ? ? -69.79 2.37 19 4 PRO A 75 ? ? -69.75 2.56 20 4 SER A 76 ? ? -35.39 110.93 21 5 ARG A 10 ? ? -42.83 154.88 22 5 PRO A 75 ? ? -69.73 94.83 23 6 ARG A 10 ? ? -45.28 155.08 24 6 VAL A 18 ? ? -59.78 108.31 25 6 GLU A 34 ? ? -37.17 142.74 26 6 HIS A 35 ? ? 71.04 46.05 27 7 SER A 6 ? ? -91.48 55.21 28 7 ARG A 10 ? ? -64.31 -176.53 29 7 ASN A 11 ? ? -112.39 67.67 30 7 GLU A 47 ? ? -92.40 -60.65 31 7 PRO A 70 ? ? -69.80 2.66 32 7 THR A 71 ? ? -41.51 105.34 33 8 SER A 5 ? ? -65.40 91.71 34 8 ASN A 11 ? ? -112.46 76.18 35 8 PRO A 27 ? ? -69.70 1.38 36 8 ASP A 43 ? ? -93.21 32.32 37 8 SER A 73 ? ? -44.08 163.45 38 9 SER A 2 ? ? 39.46 43.85 39 9 SER A 6 ? ? -60.80 93.22 40 9 THR A 8 ? ? -59.64 93.74 41 9 ARG A 10 ? ? -34.55 106.44 42 9 ALA A 24 ? ? -57.28 102.67 43 9 GLU A 29 ? ? -69.38 -178.74 44 9 PRO A 70 ? ? -69.75 92.16 45 10 SER A 2 ? ? -50.12 103.75 46 10 LEU A 9 ? ? -94.48 43.96 47 10 TYR A 22 ? ? -164.47 109.05 48 10 SER A 72 ? ? -54.11 105.52 49 10 PRO A 75 ? ? -69.72 95.97 50 11 ASP A 43 ? ? -92.25 31.31 51 11 ASP A 48 ? ? -104.90 48.07 52 12 SER A 3 ? ? -37.53 154.64 53 12 THR A 8 ? ? -46.30 160.10 54 12 ARG A 10 ? ? -45.23 165.21 55 12 ASN A 11 ? ? -110.29 72.85 56 12 ASP A 43 ? ? -96.84 36.22 57 12 ASP A 48 ? ? -87.86 44.52 58 12 SER A 72 ? ? -174.91 148.54 59 13 ASN A 11 ? ? -113.67 69.47 60 13 ASP A 43 ? ? -98.44 32.23 61 13 THR A 71 ? ? -34.61 115.89 62 13 PRO A 75 ? ? -69.80 -172.52 63 13 SER A 77 ? ? -50.23 98.73 64 14 SER A 6 ? ? -51.93 97.88 65 14 TYR A 22 ? ? -163.81 113.55 66 14 GLU A 34 ? ? -35.72 142.99 67 15 ASP A 43 ? ? -99.02 45.08 68 15 SER A 73 ? ? -36.77 -33.50 69 16 VAL A 18 ? ? -58.41 101.34 70 16 HIS A 35 ? ? 70.68 39.00 71 16 SER A 77 ? ? -86.93 48.83 72 17 SER A 2 ? ? -38.47 145.51 73 17 SER A 3 ? ? -103.91 -60.35 74 17 SER A 5 ? ? -43.67 109.44 75 17 SER A 6 ? ? -58.34 100.91 76 17 ALA A 24 ? ? -39.18 145.16 77 17 GLU A 34 ? ? -39.13 142.00 78 17 ASP A 43 ? ? -97.90 40.76 79 17 SER A 72 ? ? -160.40 118.85 80 17 PRO A 75 ? ? -69.79 98.23 81 18 SER A 6 ? ? -34.49 140.79 82 18 VAL A 18 ? ? -60.18 99.24 83 18 GLU A 34 ? ? -38.77 144.70 84 18 ASP A 43 ? ? -98.34 34.67 85 18 ASP A 48 ? ? -105.51 41.30 86 18 PRO A 70 ? ? -69.71 82.01 87 18 PRO A 75 ? ? -69.76 97.62 88 18 SER A 76 ? ? -174.71 135.34 89 19 THR A 71 ? ? 70.70 37.36 90 19 SER A 73 ? ? -168.74 117.84 91 20 SER A 3 ? ? -52.25 177.22 92 20 LEU A 9 ? ? -39.15 152.87 93 20 GLU A 34 ? ? -39.32 143.93 94 20 ASP A 43 ? ? -99.80 51.22 95 20 PRO A 75 ? ? -69.78 2.66 96 20 SER A 76 ? ? -34.86 141.95 #