data_2DLQ # _entry.id 2DLQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DLQ pdb_00002dlq 10.2210/pdb2dlq/pdb RCSB RCSB025561 ? ? WWPDB D_1000025561 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-10-20 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 4 'Structure model' struct_site 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 5 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 6 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 10 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 16 4 'Structure model' '_struct_ref_seq_dif.details' 17 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 18 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 19 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DLQ _pdbx_database_status.recvd_initial_deposition_date 2006-04-20 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id mmi002017035.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Inoue, K.' 1 'Hayashi, F.' 2 'Izumi, K.' 3 'Yoshida, M.' 4 'Yokoyama, S.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title 'Solution structure of the tandem four zf-C2H2 domain repeats of murine GLI-Kruppel family member HKR3' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Inoue, K.' 1 ? primary 'Hayashi, F.' 2 ? primary 'Izumi, K.' 3 ? primary 'Yoshida, M.' 4 ? primary 'Yokoyama, S.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'GLI-Kruppel family member HKR3' 14384.654 1 ? ? 'zf-C2H2 domain, residues 8-118' ? 2 non-polymer syn 'ZINC ION' 65.409 4 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGVECPTCHKKFLSKYYLKVHNRKHTGEKPFECPKCGKCYFRKENLLEHEARNCMNRSEQVFTCSVCQETFRRRM ELRLHMVSHTGEMPYKCSSCSQQFMQKKDLQSHMIKLHSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGVECPTCHKKFLSKYYLKVHNRKHTGEKPFECPKCGKCYFRKENLLEHEARNCMNRSEQVFTCSVCQETFRRRM ELRLHMVSHTGEMPYKCSSCSQQFMQKKDLQSHMIKLHSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier mmi002017035.1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 VAL n 1 9 GLU n 1 10 CYS n 1 11 PRO n 1 12 THR n 1 13 CYS n 1 14 HIS n 1 15 LYS n 1 16 LYS n 1 17 PHE n 1 18 LEU n 1 19 SER n 1 20 LYS n 1 21 TYR n 1 22 TYR n 1 23 LEU n 1 24 LYS n 1 25 VAL n 1 26 HIS n 1 27 ASN n 1 28 ARG n 1 29 LYS n 1 30 HIS n 1 31 THR n 1 32 GLY n 1 33 GLU n 1 34 LYS n 1 35 PRO n 1 36 PHE n 1 37 GLU n 1 38 CYS n 1 39 PRO n 1 40 LYS n 1 41 CYS n 1 42 GLY n 1 43 LYS n 1 44 CYS n 1 45 TYR n 1 46 PHE n 1 47 ARG n 1 48 LYS n 1 49 GLU n 1 50 ASN n 1 51 LEU n 1 52 LEU n 1 53 GLU n 1 54 HIS n 1 55 GLU n 1 56 ALA n 1 57 ARG n 1 58 ASN n 1 59 CYS n 1 60 MET n 1 61 ASN n 1 62 ARG n 1 63 SER n 1 64 GLU n 1 65 GLN n 1 66 VAL n 1 67 PHE n 1 68 THR n 1 69 CYS n 1 70 SER n 1 71 VAL n 1 72 CYS n 1 73 GLN n 1 74 GLU n 1 75 THR n 1 76 PHE n 1 77 ARG n 1 78 ARG n 1 79 ARG n 1 80 MET n 1 81 GLU n 1 82 LEU n 1 83 ARG n 1 84 LEU n 1 85 HIS n 1 86 MET n 1 87 VAL n 1 88 SER n 1 89 HIS n 1 90 THR n 1 91 GLY n 1 92 GLU n 1 93 MET n 1 94 PRO n 1 95 TYR n 1 96 LYS n 1 97 CYS n 1 98 SER n 1 99 SER n 1 100 CYS n 1 101 SER n 1 102 GLN n 1 103 GLN n 1 104 PHE n 1 105 MET n 1 106 GLN n 1 107 LYS n 1 108 LYS n 1 109 ASP n 1 110 LEU n 1 111 GLN n 1 112 SER n 1 113 HIS n 1 114 MET n 1 115 ILE n 1 116 LYS n 1 117 LEU n 1 118 HIS n 1 119 SER n 1 120 GLY n 1 121 PRO n 1 122 SER n 1 123 SER n 1 124 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene Hkr3 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cell free synthesis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050302-67 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 HIS 26 26 26 HIS HIS A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 CYS 69 69 69 CYS CYS A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 CYS 72 72 72 CYS CYS A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 MET 80 80 80 MET MET A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 HIS 85 85 85 HIS HIS A . n A 1 86 MET 86 86 86 MET MET A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 HIS 89 89 89 HIS HIS A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 MET 93 93 93 MET MET A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 CYS 97 97 97 CYS CYS A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 CYS 100 100 100 CYS CYS A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 GLN 102 102 102 GLN GLN A . n A 1 103 GLN 103 103 103 GLN GLN A . n A 1 104 PHE 104 104 104 PHE PHE A . n A 1 105 MET 105 105 105 MET MET A . n A 1 106 GLN 106 106 106 GLN GLN A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 GLN 111 111 111 GLN GLN A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 HIS 113 113 113 HIS HIS A . n A 1 114 MET 114 114 114 MET MET A . n A 1 115 ILE 115 115 115 ILE ILE A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 HIS 118 118 118 HIS HIS A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 PRO 121 121 121 PRO PRO A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 SER 123 123 123 SER SER A . n A 1 124 GLY 124 124 124 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 200 200 ZN ZN A . C 2 ZN 1 300 300 ZN ZN A . D 2 ZN 1 400 400 ZN ZN A . E 2 ZN 1 500 500 ZN ZN A . # _exptl.entry_id 2DLQ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2DLQ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2DLQ _struct.title 'Solution structure of the tandem four zf-C2H2 domain repeats of murine GLI-Kruppel family member HKR3' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DLQ _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text ;zf-C2H2 domain, GLI-Kruppel family member HKR3, Hkr3, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q99K15_MOUSE _struct_ref.pdbx_db_accession Q99K15 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 284 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DLQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 118 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q99K15 _struct_ref_seq.db_align_beg 284 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 394 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 118 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DLQ GLY A 1 ? UNP Q99K15 ? ? 'cloning artifact' 1 1 1 2DLQ SER A 2 ? UNP Q99K15 ? ? 'cloning artifact' 2 2 1 2DLQ SER A 3 ? UNP Q99K15 ? ? 'cloning artifact' 3 3 1 2DLQ GLY A 4 ? UNP Q99K15 ? ? 'cloning artifact' 4 4 1 2DLQ SER A 5 ? UNP Q99K15 ? ? 'cloning artifact' 5 5 1 2DLQ SER A 6 ? UNP Q99K15 ? ? 'cloning artifact' 6 6 1 2DLQ GLY A 7 ? UNP Q99K15 ? ? 'cloning artifact' 7 7 1 2DLQ SER A 119 ? UNP Q99K15 ? ? 'cloning artifact' 119 8 1 2DLQ GLY A 120 ? UNP Q99K15 ? ? 'cloning artifact' 120 9 1 2DLQ PRO A 121 ? UNP Q99K15 ? ? 'cloning artifact' 121 10 1 2DLQ SER A 122 ? UNP Q99K15 ? ? 'cloning artifact' 122 11 1 2DLQ SER A 123 ? UNP Q99K15 ? ? 'cloning artifact' 123 12 1 2DLQ GLY A 124 ? UNP Q99K15 ? ? 'cloning artifact' 124 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 19 ? THR A 31 ? SER A 19 THR A 31 1 ? 13 HELX_P HELX_P2 2 ARG A 47 ? ASN A 58 ? ARG A 47 ASN A 58 1 ? 12 HELX_P HELX_P3 3 ARG A 78 ? THR A 90 ? ARG A 78 THR A 90 1 ? 13 HELX_P HELX_P4 4 GLN A 106 ? LEU A 117 ? GLN A 106 LEU A 117 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 10 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 10 A ZN 200 1_555 ? ? ? ? ? ? ? 2.362 ? ? metalc2 metalc ? ? A CYS 13 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 13 A ZN 200 1_555 ? ? ? ? ? ? ? 2.357 ? ? metalc3 metalc ? ? A HIS 26 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 26 A ZN 200 1_555 ? ? ? ? ? ? ? 2.053 ? ? metalc4 metalc ? ? A HIS 30 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 30 A ZN 200 1_555 ? ? ? ? ? ? ? 2.048 ? ? metalc5 metalc ? ? A CYS 38 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 38 A ZN 300 1_555 ? ? ? ? ? ? ? 2.357 ? ? metalc6 metalc ? ? A CYS 41 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 41 A ZN 300 1_555 ? ? ? ? ? ? ? 2.357 ? ? metalc7 metalc ? ? A HIS 54 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 54 A ZN 300 1_555 ? ? ? ? ? ? ? 2.057 ? ? metalc8 metalc ? ? A CYS 59 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 59 A ZN 300 1_555 ? ? ? ? ? ? ? 2.057 ? ? metalc9 metalc ? ? A CYS 69 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 69 A ZN 400 1_555 ? ? ? ? ? ? ? 2.374 ? ? metalc10 metalc ? ? A CYS 72 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 72 A ZN 400 1_555 ? ? ? ? ? ? ? 2.233 ? ? metalc11 metalc ? ? A HIS 85 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 85 A ZN 400 1_555 ? ? ? ? ? ? ? 2.084 ? ? metalc12 metalc ? ? A HIS 89 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 89 A ZN 400 1_555 ? ? ? ? ? ? ? 2.061 ? ? metalc13 metalc ? ? A CYS 97 SG ? ? ? 1_555 E ZN . ZN ? ? A CYS 97 A ZN 500 1_555 ? ? ? ? ? ? ? 2.357 ? ? metalc14 metalc ? ? A CYS 100 SG ? ? ? 1_555 E ZN . ZN ? ? A CYS 100 A ZN 500 1_555 ? ? ? ? ? ? ? 2.321 ? ? metalc15 metalc ? ? A HIS 113 NE2 ? ? ? 1_555 E ZN . ZN ? ? A HIS 113 A ZN 500 1_555 ? ? ? ? ? ? ? 2.055 ? ? metalc16 metalc ? ? A HIS 118 NE2 ? ? ? 1_555 E ZN . ZN ? ? A HIS 118 A ZN 500 1_555 ? ? ? ? ? ? ? 2.056 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 10 ? A CYS 10 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 13 ? A CYS 13 ? 1_555 109.4 ? 2 SG ? A CYS 10 ? A CYS 10 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 NE2 ? A HIS 26 ? A HIS 26 ? 1_555 107.0 ? 3 SG ? A CYS 13 ? A CYS 13 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 NE2 ? A HIS 26 ? A HIS 26 ? 1_555 104.2 ? 4 SG ? A CYS 10 ? A CYS 10 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 NE2 ? A HIS 30 ? A HIS 30 ? 1_555 104.7 ? 5 SG ? A CYS 13 ? A CYS 13 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 NE2 ? A HIS 30 ? A HIS 30 ? 1_555 114.2 ? 6 NE2 ? A HIS 26 ? A HIS 26 ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 NE2 ? A HIS 30 ? A HIS 30 ? 1_555 117.0 ? 7 SG ? A CYS 38 ? A CYS 38 ? 1_555 ZN ? C ZN . ? A ZN 300 ? 1_555 SG ? A CYS 41 ? A CYS 41 ? 1_555 103.2 ? 8 SG ? A CYS 38 ? A CYS 38 ? 1_555 ZN ? C ZN . ? A ZN 300 ? 1_555 NE2 ? A HIS 54 ? A HIS 54 ? 1_555 104.7 ? 9 SG ? A CYS 41 ? A CYS 41 ? 1_555 ZN ? C ZN . ? A ZN 300 ? 1_555 NE2 ? A HIS 54 ? A HIS 54 ? 1_555 105.0 ? 10 SG ? A CYS 38 ? A CYS 38 ? 1_555 ZN ? C ZN . ? A ZN 300 ? 1_555 SG ? A CYS 59 ? A CYS 59 ? 1_555 114.7 ? 11 SG ? A CYS 41 ? A CYS 41 ? 1_555 ZN ? C ZN . ? A ZN 300 ? 1_555 SG ? A CYS 59 ? A CYS 59 ? 1_555 111.3 ? 12 NE2 ? A HIS 54 ? A HIS 54 ? 1_555 ZN ? C ZN . ? A ZN 300 ? 1_555 SG ? A CYS 59 ? A CYS 59 ? 1_555 116.6 ? 13 SG ? A CYS 69 ? A CYS 69 ? 1_555 ZN ? D ZN . ? A ZN 400 ? 1_555 SG ? A CYS 72 ? A CYS 72 ? 1_555 113.6 ? 14 SG ? A CYS 69 ? A CYS 69 ? 1_555 ZN ? D ZN . ? A ZN 400 ? 1_555 NE2 ? A HIS 85 ? A HIS 85 ? 1_555 102.9 ? 15 SG ? A CYS 72 ? A CYS 72 ? 1_555 ZN ? D ZN . ? A ZN 400 ? 1_555 NE2 ? A HIS 85 ? A HIS 85 ? 1_555 107.5 ? 16 SG ? A CYS 69 ? A CYS 69 ? 1_555 ZN ? D ZN . ? A ZN 400 ? 1_555 NE2 ? A HIS 89 ? A HIS 89 ? 1_555 109.0 ? 17 SG ? A CYS 72 ? A CYS 72 ? 1_555 ZN ? D ZN . ? A ZN 400 ? 1_555 NE2 ? A HIS 89 ? A HIS 89 ? 1_555 109.7 ? 18 NE2 ? A HIS 85 ? A HIS 85 ? 1_555 ZN ? D ZN . ? A ZN 400 ? 1_555 NE2 ? A HIS 89 ? A HIS 89 ? 1_555 114.2 ? 19 SG ? A CYS 97 ? A CYS 97 ? 1_555 ZN ? E ZN . ? A ZN 500 ? 1_555 SG ? A CYS 100 ? A CYS 100 ? 1_555 108.8 ? 20 SG ? A CYS 97 ? A CYS 97 ? 1_555 ZN ? E ZN . ? A ZN 500 ? 1_555 NE2 ? A HIS 113 ? A HIS 113 ? 1_555 104.7 ? 21 SG ? A CYS 100 ? A CYS 100 ? 1_555 ZN ? E ZN . ? A ZN 500 ? 1_555 NE2 ? A HIS 113 ? A HIS 113 ? 1_555 106.0 ? 22 SG ? A CYS 97 ? A CYS 97 ? 1_555 ZN ? E ZN . ? A ZN 500 ? 1_555 NE2 ? A HIS 118 ? A HIS 118 ? 1_555 104.6 ? 23 SG ? A CYS 100 ? A CYS 100 ? 1_555 ZN ? E ZN . ? A ZN 500 ? 1_555 NE2 ? A HIS 118 ? A HIS 118 ? 1_555 115.4 ? 24 NE2 ? A HIS 113 ? A HIS 113 ? 1_555 ZN ? E ZN . ? A ZN 500 ? 1_555 NE2 ? A HIS 118 ? A HIS 118 ? 1_555 116.7 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 67 ? THR A 68 ? PHE A 67 THR A 68 A 2 THR A 75 ? PHE A 76 ? THR A 75 PHE A 76 B 1 TYR A 95 ? LYS A 96 ? TYR A 95 LYS A 96 B 2 GLN A 103 ? PHE A 104 ? GLN A 103 PHE A 104 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N PHE A 67 ? N PHE A 67 O PHE A 76 ? O PHE A 76 B 1 2 N TYR A 95 ? N TYR A 95 O PHE A 104 ? O PHE A 104 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 200 ? 4 'BINDING SITE FOR RESIDUE ZN A 200' AC2 Software A ZN 300 ? 4 'BINDING SITE FOR RESIDUE ZN A 300' AC3 Software A ZN 400 ? 4 'BINDING SITE FOR RESIDUE ZN A 400' AC4 Software A ZN 500 ? 4 'BINDING SITE FOR RESIDUE ZN A 500' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 10 ? CYS A 10 . ? 1_555 ? 2 AC1 4 CYS A 13 ? CYS A 13 . ? 1_555 ? 3 AC1 4 HIS A 26 ? HIS A 26 . ? 1_555 ? 4 AC1 4 HIS A 30 ? HIS A 30 . ? 1_555 ? 5 AC2 4 CYS A 38 ? CYS A 38 . ? 1_555 ? 6 AC2 4 CYS A 41 ? CYS A 41 . ? 1_555 ? 7 AC2 4 HIS A 54 ? HIS A 54 . ? 1_555 ? 8 AC2 4 CYS A 59 ? CYS A 59 . ? 1_555 ? 9 AC3 4 CYS A 69 ? CYS A 69 . ? 1_555 ? 10 AC3 4 CYS A 72 ? CYS A 72 . ? 1_555 ? 11 AC3 4 HIS A 85 ? HIS A 85 . ? 1_555 ? 12 AC3 4 HIS A 89 ? HIS A 89 . ? 1_555 ? 13 AC4 4 CYS A 97 ? CYS A 97 . ? 1_555 ? 14 AC4 4 CYS A 100 ? CYS A 100 . ? 1_555 ? 15 AC4 4 HIS A 113 ? HIS A 113 . ? 1_555 ? 16 AC4 4 HIS A 118 ? HIS A 118 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 11 ? ? -69.79 9.87 2 1 MET A 60 ? ? -34.23 129.58 3 1 ASN A 61 ? ? -172.16 116.79 4 1 ARG A 62 ? ? -34.53 103.49 5 1 GLN A 65 ? ? -53.57 107.95 6 1 CYS A 69 ? ? -57.77 177.16 7 1 GLU A 74 ? ? -62.50 -173.55 8 1 SER A 101 ? ? 74.92 30.69 9 1 GLN A 102 ? ? -63.80 -174.51 10 1 SER A 123 ? ? -103.83 42.25 11 2 PRO A 11 ? ? -69.78 4.48 12 2 LYS A 34 ? ? -33.21 98.82 13 2 PRO A 35 ? ? -69.74 6.09 14 2 GLU A 37 ? ? -172.45 130.18 15 2 PRO A 39 ? ? -69.74 1.56 16 2 GLU A 64 ? ? -64.74 -177.18 17 2 CYS A 69 ? ? -50.88 172.67 18 2 VAL A 71 ? ? -133.36 -45.56 19 2 GLU A 74 ? ? -55.60 -173.59 20 2 GLN A 102 ? ? -64.73 -174.84 21 2 HIS A 118 ? ? -89.91 34.76 22 3 SER A 2 ? ? -48.78 157.84 23 3 PRO A 11 ? ? -69.78 11.68 24 3 LYS A 34 ? ? -42.62 151.20 25 3 PRO A 39 ? ? -69.73 0.92 26 3 TYR A 45 ? ? -167.72 107.85 27 3 MET A 60 ? ? -42.99 153.65 28 3 CYS A 69 ? ? -56.80 172.25 29 3 GLU A 74 ? ? -57.41 -174.87 30 3 GLN A 102 ? ? -69.09 -174.29 31 3 HIS A 118 ? ? -90.44 39.96 32 3 SER A 119 ? ? -75.98 49.21 33 3 SER A 123 ? ? -170.86 139.12 34 4 PRO A 11 ? ? -69.77 5.05 35 4 GLU A 37 ? ? -170.91 123.15 36 4 CYS A 38 ? ? -36.37 105.74 37 4 PRO A 39 ? ? -69.74 2.10 38 4 TYR A 45 ? ? -165.10 114.62 39 4 ARG A 57 ? ? -54.16 -70.26 40 4 GLN A 65 ? ? -45.56 104.41 41 4 CYS A 69 ? ? -53.34 172.39 42 4 VAL A 71 ? ? -134.13 -44.56 43 4 GLU A 74 ? ? -56.15 -173.60 44 4 GLN A 102 ? ? -60.75 -173.69 45 4 HIS A 118 ? ? -90.69 34.15 46 4 SER A 119 ? ? -61.78 -71.19 47 5 PRO A 11 ? ? -69.76 6.36 48 5 PRO A 39 ? ? -69.74 0.68 49 5 GLN A 102 ? ? -65.37 -175.14 50 5 HIS A 118 ? ? -87.42 35.42 51 5 SER A 119 ? ? -61.46 86.01 52 6 PRO A 11 ? ? -69.74 6.36 53 6 MET A 60 ? ? -36.59 147.14 54 6 GLN A 65 ? ? -35.16 112.83 55 6 GLN A 73 ? ? 71.74 31.37 56 6 GLU A 74 ? ? -56.95 -174.76 57 6 GLN A 102 ? ? -61.57 -174.75 58 6 HIS A 118 ? ? -97.84 37.29 59 7 PRO A 11 ? ? -69.74 4.98 60 7 PRO A 35 ? ? -69.79 2.20 61 7 PRO A 39 ? ? -69.69 0.83 62 7 CYS A 59 ? ? -174.59 111.51 63 7 MET A 60 ? ? -49.47 156.53 64 7 SER A 63 ? ? -173.46 134.65 65 7 CYS A 69 ? ? -55.96 172.35 66 7 VAL A 71 ? ? -133.82 -44.65 67 7 GLU A 74 ? ? -64.58 -174.73 68 7 GLU A 92 ? ? -174.54 143.80 69 7 GLN A 102 ? ? -59.56 -174.11 70 7 HIS A 118 ? ? -88.95 32.83 71 8 PRO A 11 ? ? -69.78 10.59 72 8 HIS A 30 ? ? -55.74 -75.15 73 8 LYS A 34 ? ? -172.84 122.99 74 8 PRO A 39 ? ? -69.80 1.59 75 8 HIS A 54 ? ? -36.13 -38.08 76 8 CYS A 59 ? ? -94.66 -62.08 77 8 CYS A 69 ? ? -57.02 173.82 78 8 GLU A 74 ? ? -61.14 -176.28 79 8 GLN A 102 ? ? -61.27 -173.15 80 9 PRO A 11 ? ? -69.75 9.86 81 9 THR A 12 ? ? -105.21 -60.36 82 9 CYS A 38 ? ? -54.91 108.06 83 9 PRO A 39 ? ? -69.73 2.73 84 9 TYR A 45 ? ? -174.97 110.49 85 9 MET A 60 ? ? -41.48 103.93 86 9 ASN A 61 ? ? -134.04 -52.91 87 9 ARG A 62 ? ? -124.06 -53.86 88 9 GLN A 65 ? ? -32.85 105.97 89 9 GLU A 74 ? ? -58.89 -179.32 90 9 GLU A 92 ? ? -171.54 147.91 91 9 GLN A 102 ? ? -65.71 -175.04 92 9 HIS A 118 ? ? -88.46 37.52 93 9 SER A 119 ? ? -57.97 85.93 94 9 SER A 122 ? ? -163.71 117.68 95 10 PRO A 11 ? ? -69.78 19.56 96 10 ARG A 28 ? ? -34.36 -38.43 97 10 HIS A 30 ? ? -76.09 -71.33 98 10 THR A 31 ? ? 29.48 54.22 99 10 CYS A 38 ? ? -40.09 108.33 100 10 PRO A 39 ? ? -69.67 2.82 101 10 TYR A 45 ? ? -160.06 108.18 102 10 CYS A 69 ? ? -58.01 171.72 103 10 GLU A 74 ? ? -56.85 -176.09 104 10 GLU A 92 ? ? -173.01 149.38 105 10 SER A 101 ? ? 73.81 31.57 106 10 GLN A 102 ? ? -60.56 -174.61 107 10 HIS A 118 ? ? -87.37 35.33 108 10 PRO A 121 ? ? -69.76 12.49 109 11 SER A 2 ? ? 35.89 41.81 110 11 PRO A 11 ? ? -69.73 6.79 111 11 ARG A 28 ? ? -34.31 -39.02 112 11 CYS A 38 ? ? -58.56 109.60 113 11 PRO A 39 ? ? -69.76 2.51 114 11 SER A 63 ? ? -49.97 99.36 115 11 CYS A 69 ? ? -56.25 173.93 116 11 GLU A 74 ? ? -60.34 -175.94 117 11 GLN A 102 ? ? -64.44 -173.77 118 11 HIS A 118 ? ? -90.11 35.84 119 12 SER A 3 ? ? -170.64 139.59 120 12 PRO A 11 ? ? -69.73 5.15 121 12 THR A 31 ? ? -52.86 107.19 122 12 PRO A 39 ? ? -69.76 1.73 123 12 CYS A 44 ? ? -49.54 171.43 124 12 TYR A 45 ? ? -173.49 126.80 125 12 MET A 60 ? ? -41.60 104.86 126 12 GLU A 64 ? ? -171.37 123.98 127 12 CYS A 69 ? ? -55.57 173.90 128 12 GLU A 74 ? ? -58.41 -178.58 129 12 GLN A 102 ? ? -64.03 -173.53 130 12 HIS A 118 ? ? -90.22 36.29 131 13 SER A 3 ? ? -96.31 -61.97 132 13 PRO A 11 ? ? -69.73 5.63 133 13 TYR A 45 ? ? -160.92 109.99 134 13 CYS A 69 ? ? -47.36 175.05 135 13 GLU A 74 ? ? -53.22 -174.81 136 13 GLN A 102 ? ? -62.66 -174.54 137 13 HIS A 118 ? ? -88.67 37.75 138 13 SER A 119 ? ? -57.97 84.59 139 14 PRO A 11 ? ? -69.79 8.34 140 14 THR A 12 ? ? -105.01 -61.00 141 14 PRO A 35 ? ? -69.73 8.37 142 14 PRO A 39 ? ? -69.79 1.02 143 14 GLU A 64 ? ? -38.98 126.38 144 14 CYS A 69 ? ? -50.16 176.94 145 14 GLU A 74 ? ? -57.27 -176.00 146 14 GLN A 102 ? ? -62.32 -174.18 147 14 HIS A 118 ? ? -86.01 32.10 148 14 SER A 119 ? ? -57.14 83.81 149 15 SER A 3 ? ? -91.80 -63.47 150 15 PRO A 11 ? ? -69.85 12.34 151 15 THR A 12 ? ? -120.71 -58.39 152 15 TYR A 21 ? ? -37.27 -39.53 153 15 ARG A 28 ? ? -32.87 -39.83 154 15 PRO A 35 ? ? -69.77 2.25 155 15 PRO A 39 ? ? -69.78 1.88 156 15 CYS A 59 ? ? -167.82 112.36 157 15 ASN A 61 ? ? -54.51 100.15 158 15 ARG A 62 ? ? 33.88 42.93 159 15 GLU A 74 ? ? -64.10 -176.52 160 15 GLN A 102 ? ? -60.30 -173.77 161 15 HIS A 118 ? ? -90.66 35.07 162 15 SER A 122 ? ? -173.34 125.92 163 16 PRO A 11 ? ? -69.74 3.01 164 16 LYS A 29 ? ? -36.62 -36.97 165 16 THR A 31 ? ? -47.66 164.48 166 16 PRO A 39 ? ? -69.67 1.68 167 16 TYR A 45 ? ? -163.98 110.74 168 16 MET A 60 ? ? -58.71 93.11 169 16 GLN A 65 ? ? -34.29 114.28 170 16 CYS A 69 ? ? -58.33 170.28 171 16 GLU A 74 ? ? -60.42 -178.71 172 16 SER A 101 ? ? 74.54 30.54 173 16 GLN A 102 ? ? -65.75 -175.00 174 16 HIS A 118 ? ? -89.16 34.24 175 16 SER A 123 ? ? -98.18 42.13 176 17 SER A 5 ? ? -64.15 86.05 177 17 PRO A 11 ? ? -69.74 5.05 178 17 PRO A 39 ? ? -69.80 1.22 179 17 CYS A 44 ? ? -44.63 167.16 180 17 TYR A 45 ? ? -175.25 111.04 181 17 MET A 60 ? ? -33.73 143.83 182 17 GLU A 64 ? ? -61.05 -175.94 183 17 GLN A 65 ? ? -34.97 112.95 184 17 GLU A 74 ? ? -59.60 -178.25 185 17 GLN A 102 ? ? -63.27 -175.75 186 17 HIS A 118 ? ? -94.51 38.43 187 18 SER A 5 ? ? -93.74 43.36 188 18 PRO A 11 ? ? -69.71 4.80 189 18 PRO A 39 ? ? -69.77 0.54 190 18 ARG A 62 ? ? -79.33 44.96 191 18 CYS A 69 ? ? -56.86 171.41 192 18 GLU A 74 ? ? -58.79 -175.81 193 18 GLN A 102 ? ? -64.97 -174.75 194 18 HIS A 118 ? ? -88.08 32.99 195 18 PRO A 121 ? ? -69.75 -176.87 196 19 PRO A 11 ? ? -69.72 5.05 197 19 GLU A 33 ? ? -48.99 161.87 198 19 PRO A 35 ? ? -69.77 4.62 199 19 MET A 60 ? ? -39.49 159.80 200 19 CYS A 69 ? ? -58.61 170.76 201 19 GLU A 74 ? ? -59.25 -178.44 202 19 MET A 93 ? ? -42.19 155.46 203 19 GLN A 102 ? ? -62.34 -175.26 204 19 HIS A 118 ? ? -102.42 45.67 205 19 SER A 119 ? ? -75.88 48.61 206 20 SER A 2 ? ? -174.45 131.04 207 20 PRO A 11 ? ? -69.80 8.67 208 20 PRO A 35 ? ? -69.76 4.90 209 20 PRO A 39 ? ? -69.77 0.35 210 20 CYS A 59 ? ? -128.30 -61.50 211 20 ARG A 62 ? ? -172.57 130.28 212 20 GLN A 65 ? ? -50.13 105.50 213 20 GLU A 74 ? ? -56.35 -179.18 214 20 GLN A 102 ? ? -68.43 -174.31 215 20 HIS A 118 ? ? -87.28 35.24 216 20 PRO A 121 ? ? -69.69 24.74 217 20 SER A 122 ? ? -26.52 104.04 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 2DLQ _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DLQ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1.20mM U-15N, 13C-labeled protein; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 50uM ZnCl2+1mM IDA; 10% D2O, 90% H2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_details.entry_id 2DLQ _pdbx_nmr_details.text 'spectrometer_id 1 for 3D_15N_separated_NOESY; spectrometer_id 2 for 3D_13C_separated_NOESY;' # _pdbx_nmr_refine.entry_id 2DLQ _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.93191 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 ZN ZN ZN N N 361 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 INOVA Varian 800 ? 2 INOVA Varian 900 ? # _atom_sites.entry_id 2DLQ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ #