data_2DLS # _entry.id 2DLS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DLS pdb_00002dls 10.2210/pdb2dls/pdb RCSB RCSB025563 ? ? WWPDB D_1000025563 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk002000370.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DLS _pdbx_database_status.recvd_initial_deposition_date 2006-04-20 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Inoue, K.' 1 'Suetake, T.' 2 'Hayashi, F.' 3 'Yokoyama, S.' 4 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 # _citation.id primary _citation.title 'Solution structure of the PDZ domain of human Rho guanine nucleotide exchange factor 11' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Inoue, K.' 1 ? primary 'Suetake, T.' 2 ? primary 'Hayashi, F.' 3 ? primary 'Yokoyama, S.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Rho guanine nucleotide exchange factor 11' _entity.formula_weight 9441.792 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'PDZ domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name PDZ-RhoGEF # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGVQRCVIIQKDQHGFGFTVSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVA LTLLGSSSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGVQRCVIIQKDQHGFGFTVSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVA LTLLGSSSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk002000370.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 VAL n 1 9 GLN n 1 10 ARG n 1 11 CYS n 1 12 VAL n 1 13 ILE n 1 14 ILE n 1 15 GLN n 1 16 LYS n 1 17 ASP n 1 18 GLN n 1 19 HIS n 1 20 GLY n 1 21 PHE n 1 22 GLY n 1 23 PHE n 1 24 THR n 1 25 VAL n 1 26 SER n 1 27 GLY n 1 28 ASP n 1 29 ARG n 1 30 ILE n 1 31 VAL n 1 32 LEU n 1 33 VAL n 1 34 GLN n 1 35 SER n 1 36 VAL n 1 37 ARG n 1 38 PRO n 1 39 GLY n 1 40 GLY n 1 41 ALA n 1 42 ALA n 1 43 MET n 1 44 LYS n 1 45 ALA n 1 46 GLY n 1 47 VAL n 1 48 LYS n 1 49 GLU n 1 50 GLY n 1 51 ASP n 1 52 ARG n 1 53 ILE n 1 54 ILE n 1 55 LYS n 1 56 VAL n 1 57 ASN n 1 58 GLY n 1 59 THR n 1 60 MET n 1 61 VAL n 1 62 THR n 1 63 ASN n 1 64 SER n 1 65 SER n 1 66 HIS n 1 67 LEU n 1 68 GLU n 1 69 VAL n 1 70 VAL n 1 71 LYS n 1 72 LEU n 1 73 ILE n 1 74 LYS n 1 75 SER n 1 76 GLY n 1 77 ALA n 1 78 TYR n 1 79 VAL n 1 80 ALA n 1 81 LEU n 1 82 THR n 1 83 LEU n 1 84 LEU n 1 85 GLY n 1 86 SER n 1 87 SER n 1 88 SER n 1 89 GLY n 1 90 PRO n 1 91 SER n 1 92 SER n 1 93 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'ARHGEF11, KIAA0380' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cell free synthesis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050919-12 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ARHGB_HUMAN _struct_ref.pdbx_db_accession O15085 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 44 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DLS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 87 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O15085 _struct_ref_seq.db_align_beg 44 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 123 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 87 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DLS GLY A 1 ? UNP O15085 ? ? 'cloning artifact' 1 1 1 2DLS SER A 2 ? UNP O15085 ? ? 'cloning artifact' 2 2 1 2DLS SER A 3 ? UNP O15085 ? ? 'cloning artifact' 3 3 1 2DLS GLY A 4 ? UNP O15085 ? ? 'cloning artifact' 4 4 1 2DLS SER A 5 ? UNP O15085 ? ? 'cloning artifact' 5 5 1 2DLS SER A 6 ? UNP O15085 ? ? 'cloning artifact' 6 6 1 2DLS GLY A 7 ? UNP O15085 ? ? 'cloning artifact' 7 7 1 2DLS SER A 88 ? UNP O15085 ? ? 'cloning artifact' 88 8 1 2DLS GLY A 89 ? UNP O15085 ? ? 'cloning artifact' 89 9 1 2DLS PRO A 90 ? UNP O15085 ? ? 'cloning artifact' 90 10 1 2DLS SER A 91 ? UNP O15085 ? ? 'cloning artifact' 91 11 1 2DLS SER A 92 ? UNP O15085 ? ? 'cloning artifact' 92 12 1 2DLS GLY A 93 ? UNP O15085 ? ? 'cloning artifact' 93 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.20mM U-15N, 13C-labeled protein; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2DLS _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2DLS _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DLS _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.93191 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2DLS _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2DLS _struct.title 'Solution structure of the PDZ domain of human Rho guanine nucleotide exchange factor 11' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DLS _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text ;PDZ domain, Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF, ARHGEF11, KIAA0380, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 42 ? ALA A 45 ? ALA A 42 ALA A 45 1 ? 4 HELX_P HELX_P2 2 SER A 65 ? LYS A 74 ? SER A 65 LYS A 74 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 9 ? GLN A 15 ? GLN A 9 GLN A 15 A 2 TYR A 78 ? LEU A 84 ? TYR A 78 LEU A 84 A 3 ARG A 52 ? VAL A 56 ? ARG A 52 VAL A 56 A 4 THR A 59 ? MET A 60 ? THR A 59 MET A 60 B 1 PHE A 23 ? SER A 26 ? PHE A 23 SER A 26 B 2 LEU A 32 ? VAL A 36 ? LEU A 32 VAL A 36 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 12 ? N VAL A 12 O LEU A 81 ? O LEU A 81 A 2 3 O THR A 82 ? O THR A 82 N ILE A 54 ? N ILE A 54 A 3 4 N VAL A 56 ? N VAL A 56 O THR A 59 ? O THR A 59 B 1 2 N THR A 24 ? N THR A 24 O GLN A 34 ? O GLN A 34 # _database_PDB_matrix.entry_id 2DLS _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DLS _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 HIS 66 66 66 HIS HIS A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 GLY 93 93 93 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-10-20 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX Determination method: Author determined ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 5 ? ? -40.90 109.95 2 1 GLN A 18 ? ? -112.37 61.26 3 1 SER A 26 ? ? -171.00 129.54 4 1 ASP A 28 ? ? -73.89 -70.90 5 1 VAL A 33 ? ? -58.67 109.34 6 1 SER A 64 ? ? -39.08 158.30 7 2 SER A 2 ? ? 37.62 42.48 8 2 PHE A 21 ? ? -35.97 151.28 9 2 SER A 26 ? ? -172.42 141.31 10 2 SER A 86 ? ? -43.97 155.16 11 2 SER A 88 ? ? -36.05 123.69 12 2 PRO A 90 ? ? -69.79 95.30 13 3 LYS A 16 ? ? -35.46 148.59 14 3 ARG A 37 ? ? -36.72 142.05 15 3 PRO A 38 ? ? -69.76 89.50 16 3 ASN A 63 ? ? -118.64 65.53 17 4 GLN A 18 ? ? -38.45 -31.53 18 4 VAL A 33 ? ? -46.41 106.54 19 4 ARG A 37 ? ? -38.65 140.64 20 4 SER A 75 ? ? -50.31 92.44 21 5 SER A 3 ? ? -171.11 134.53 22 5 ASP A 17 ? ? -131.49 -40.60 23 5 GLN A 18 ? ? -118.27 65.08 24 5 ASP A 28 ? ? -63.83 -70.17 25 5 PRO A 38 ? ? -69.75 82.19 26 5 SER A 64 ? ? -42.65 159.52 27 5 LYS A 74 ? ? -95.66 58.56 28 5 SER A 91 ? ? -47.26 160.42 29 6 GLN A 18 ? ? -134.99 -67.23 30 6 ASP A 28 ? ? -79.28 -74.84 31 6 PRO A 38 ? ? -69.77 99.29 32 6 ALA A 41 ? ? -124.33 -50.67 33 6 ASN A 63 ? ? 71.05 33.51 34 7 GLN A 18 ? ? -109.35 42.79 35 7 ARG A 29 ? ? -106.48 -68.36 36 7 ARG A 37 ? ? -34.96 139.84 37 7 PRO A 38 ? ? -69.78 88.47 38 7 VAL A 61 ? ? -97.41 34.00 39 7 SER A 64 ? ? -43.90 150.78 40 8 LYS A 16 ? ? -38.91 137.22 41 8 ASP A 17 ? ? -107.57 -70.76 42 8 THR A 62 ? ? -132.03 -36.22 43 8 LYS A 74 ? ? -95.49 53.22 44 9 SER A 3 ? ? -99.26 -61.93 45 9 SER A 5 ? ? -38.11 131.81 46 9 SER A 26 ? ? -173.68 144.17 47 9 PRO A 90 ? ? -69.75 91.28 48 10 GLN A 18 ? ? -98.76 47.51 49 10 PRO A 38 ? ? -69.81 94.37 50 10 VAL A 61 ? ? -92.52 39.24 51 10 LYS A 71 ? ? -34.73 -39.99 52 10 LYS A 74 ? ? -90.49 46.74 53 10 PRO A 90 ? ? -69.80 89.04 54 10 SER A 92 ? ? -109.81 42.75 55 11 SER A 3 ? ? -51.94 94.97 56 11 GLN A 18 ? ? 70.59 36.93 57 11 ASP A 28 ? ? -77.84 -71.07 58 11 ARG A 29 ? ? -71.14 -75.08 59 11 ARG A 37 ? ? -36.77 136.69 60 11 PRO A 38 ? ? -69.75 88.69 61 11 SER A 64 ? ? -43.78 161.64 62 11 LYS A 74 ? ? -42.68 -72.01 63 11 SER A 75 ? ? -47.64 106.56 64 11 SER A 88 ? ? 36.76 51.00 65 12 PHE A 21 ? ? -65.25 -176.86 66 12 ILE A 30 ? ? -102.01 76.54 67 12 VAL A 31 ? ? -32.88 105.01 68 13 SER A 6 ? ? -68.17 88.71 69 13 ASP A 28 ? ? -70.85 -70.45 70 13 VAL A 33 ? ? -58.24 102.55 71 13 LYS A 74 ? ? -94.81 43.72 72 14 LYS A 16 ? ? -59.30 170.55 73 14 PHE A 21 ? ? -51.63 170.64 74 14 ILE A 30 ? ? -108.91 78.84 75 14 SER A 64 ? ? -37.10 154.34 76 14 LEU A 67 ? ? -38.00 -36.76 77 15 SER A 3 ? ? -57.50 171.93 78 15 LYS A 16 ? ? -34.62 118.13 79 15 HIS A 19 ? ? 38.23 42.64 80 15 PHE A 21 ? ? -49.98 168.18 81 15 VAL A 31 ? ? -35.22 97.89 82 15 VAL A 33 ? ? -57.56 108.91 83 15 PRO A 38 ? ? -69.81 90.03 84 15 HIS A 66 ? ? -69.51 -70.24 85 15 SER A 88 ? ? -63.88 74.61 86 16 SER A 5 ? ? 36.79 43.71 87 16 PHE A 21 ? ? -45.37 164.68 88 16 VAL A 31 ? ? -49.43 107.27 89 16 ARG A 37 ? ? -38.22 134.61 90 16 PRO A 38 ? ? -69.78 99.58 91 16 ALA A 41 ? ? -120.93 -52.49 92 16 MET A 60 ? ? -59.15 104.97 93 16 HIS A 66 ? ? -40.56 -71.98 94 16 GLU A 68 ? ? -39.24 -38.66 95 17 ASP A 28 ? ? -175.07 -179.19 96 17 VAL A 31 ? ? -33.19 128.38 97 17 ARG A 37 ? ? -36.61 139.56 98 17 PRO A 38 ? ? -69.73 90.17 99 17 LYS A 71 ? ? -36.66 -32.97 100 17 LYS A 74 ? ? -41.44 -73.57 101 17 SER A 75 ? ? -42.04 103.69 102 17 SER A 88 ? ? -34.65 127.00 103 17 PRO A 90 ? ? -69.77 2.70 104 18 LYS A 16 ? ? -34.47 107.87 105 18 GLN A 18 ? ? -111.66 50.39 106 18 PHE A 21 ? ? -56.05 174.60 107 18 ASP A 28 ? ? -76.18 -75.19 108 18 ARG A 29 ? ? -62.70 -73.36 109 18 ARG A 37 ? ? -36.06 135.97 110 18 PRO A 38 ? ? -69.74 82.48 111 18 ASN A 57 ? ? 48.90 29.12 112 18 SER A 87 ? ? -130.79 -61.15 113 18 SER A 88 ? ? -50.83 103.11 114 18 PRO A 90 ? ? -69.82 95.66 115 19 SER A 2 ? ? 35.29 40.96 116 19 SER A 5 ? ? -121.02 -59.10 117 19 PRO A 38 ? ? -69.71 3.61 118 19 SER A 75 ? ? -44.92 102.11 119 19 SER A 91 ? ? -34.55 131.02 120 20 SER A 3 ? ? -172.67 140.25 121 20 SER A 5 ? ? -132.47 -48.27 122 20 ASP A 28 ? ? -75.35 -70.85 123 20 ARG A 29 ? ? -66.11 -70.68 124 20 ARG A 37 ? ? -37.90 135.04 125 20 SER A 64 ? ? -51.98 -176.79 126 20 LYS A 74 ? ? -65.53 -71.86 127 20 SER A 75 ? ? -37.48 107.09 128 20 ALA A 77 ? ? -35.67 -34.70 #