data_2DLW # _entry.id 2DLW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DLW pdb_00002dlw 10.2210/pdb2dlw/pdb RCSB RCSB025567 ? ? WWPDB D_1000025567 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hso002002623.2 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DLW _pdbx_database_status.recvd_initial_deposition_date 2006-04-20 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhang, H.P.' 1 'Kurosaki, C.' 2 'Yoshida, M.' 3 'Hayashi, F.' 4 'Yokoyama, S.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title 'Solution structure of the IRS domain of human docking protein 2, isoform a' _citation.journal_abbrev 'to be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, H.P.' 1 ? primary 'Kurosaki, C.' 2 ? primary 'Yoshida, M.' 3 ? primary 'Hayashi, F.' 4 ? primary 'Yokoyama, S.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Docking protein 2, isoform a' _entity.formula_weight 12500.721 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'IRS domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGHKEFAVTMRPTEASERCHLRGSYTLRAGESALELWGGPEPGTQLYDWPYRFLRRFGRDKVTFSFEAGRRCVSG EGNFEFETRQGNEIFLALEEAISAQKNSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGHKEFAVTMRPTEASERCHLRGSYTLRAGESALELWGGPEPGTQLYDWPYRFLRRFGRDKVTFSFEAGRRCVSG EGNFEFETRQGNEIFLALEEAISAQKNSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hso002002623.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 HIS n 1 9 LYS n 1 10 GLU n 1 11 PHE n 1 12 ALA n 1 13 VAL n 1 14 THR n 1 15 MET n 1 16 ARG n 1 17 PRO n 1 18 THR n 1 19 GLU n 1 20 ALA n 1 21 SER n 1 22 GLU n 1 23 ARG n 1 24 CYS n 1 25 HIS n 1 26 LEU n 1 27 ARG n 1 28 GLY n 1 29 SER n 1 30 TYR n 1 31 THR n 1 32 LEU n 1 33 ARG n 1 34 ALA n 1 35 GLY n 1 36 GLU n 1 37 SER n 1 38 ALA n 1 39 LEU n 1 40 GLU n 1 41 LEU n 1 42 TRP n 1 43 GLY n 1 44 GLY n 1 45 PRO n 1 46 GLU n 1 47 PRO n 1 48 GLY n 1 49 THR n 1 50 GLN n 1 51 LEU n 1 52 TYR n 1 53 ASP n 1 54 TRP n 1 55 PRO n 1 56 TYR n 1 57 ARG n 1 58 PHE n 1 59 LEU n 1 60 ARG n 1 61 ARG n 1 62 PHE n 1 63 GLY n 1 64 ARG n 1 65 ASP n 1 66 LYS n 1 67 VAL n 1 68 THR n 1 69 PHE n 1 70 SER n 1 71 PHE n 1 72 GLU n 1 73 ALA n 1 74 GLY n 1 75 ARG n 1 76 ARG n 1 77 CYS n 1 78 VAL n 1 79 SER n 1 80 GLY n 1 81 GLU n 1 82 GLY n 1 83 ASN n 1 84 PHE n 1 85 GLU n 1 86 PHE n 1 87 GLU n 1 88 THR n 1 89 ARG n 1 90 GLN n 1 91 GLY n 1 92 ASN n 1 93 GLU n 1 94 ILE n 1 95 PHE n 1 96 LEU n 1 97 ALA n 1 98 LEU n 1 99 GLU n 1 100 GLU n 1 101 ALA n 1 102 ILE n 1 103 SER n 1 104 ALA n 1 105 GLN n 1 106 LYS n 1 107 ASN n 1 108 SER n 1 109 GLY n 1 110 PRO n 1 111 SER n 1 112 SER n 1 113 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene DOK2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cell free synthesis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050620-10 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8N5A4_HUMAN _struct_ref.pdbx_db_accession Q8N5A4 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 148 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DLW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 107 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8N5A4 _struct_ref_seq.db_align_beg 148 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 247 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 107 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DLW GLY A 1 ? UNP Q8N5A4 ? ? 'cloning artifact' 1 1 1 2DLW SER A 2 ? UNP Q8N5A4 ? ? 'cloning artifact' 2 2 1 2DLW SER A 3 ? UNP Q8N5A4 ? ? 'cloning artifact' 3 3 1 2DLW GLY A 4 ? UNP Q8N5A4 ? ? 'cloning artifact' 4 4 1 2DLW SER A 5 ? UNP Q8N5A4 ? ? 'cloning artifact' 5 5 1 2DLW SER A 6 ? UNP Q8N5A4 ? ? 'cloning artifact' 6 6 1 2DLW GLY A 7 ? UNP Q8N5A4 ? ? 'cloning artifact' 7 7 1 2DLW SER A 108 ? UNP Q8N5A4 ? ? 'cloning artifact' 108 8 1 2DLW GLY A 109 ? UNP Q8N5A4 ? ? 'cloning artifact' 109 9 1 2DLW PRO A 110 ? UNP Q8N5A4 ? ? 'cloning artifact' 110 10 1 2DLW SER A 111 ? UNP Q8N5A4 ? ? 'cloning artifact' 111 11 1 2DLW SER A 112 ? UNP Q8N5A4 ? ? 'cloning artifact' 112 12 1 2DLW GLY A 113 ? UNP Q8N5A4 ? ? 'cloning artifact' 113 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.91mM 13C, 15N-labeled protein; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02%NaN3, 90%H2O; 10%D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model ECA _pdbx_nmr_spectrometer.manufacturer JEOL _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2DLW _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2DLW _pdbx_nmr_details.text 'spectrometer_id 1 for 3D_15N_separated_NOESY; spectrometer_id 2 for 3D_13C_separated_NOESY' # _pdbx_nmr_ensemble.entry_id 2DLW _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DLW _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection 'Delta NMR' 4.3.2 JEOL 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.04 Johnson,B.A. 3 'data analysis' KUJIRA 0.93191 Kobayashi,N. 4 'structure solution' CYANA 2.0.17 Guntent,P. 5 refinement CYANA 2.0.17 Guntent,P. 6 # _exptl.entry_id 2DLW _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2DLW _struct.title 'Solution structure of the IRS domain of human docking protein 2, isoform a' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DLW _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text ;IRS domain, Docking protein 2, isoform a, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 19 ? CYS A 24 ? GLU A 19 CYS A 24 1 ? 6 HELX_P HELX_P2 3 GLY A 91 ? ASN A 107 ? GLY A 91 ASN A 107 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLU 46 A . ? GLU 46 A PRO 47 A ? PRO 47 A 1 -0.01 2 GLU 46 A . ? GLU 46 A PRO 47 A ? PRO 47 A 2 -0.05 3 GLU 46 A . ? GLU 46 A PRO 47 A ? PRO 47 A 3 0.02 4 GLU 46 A . ? GLU 46 A PRO 47 A ? PRO 47 A 4 0.01 5 GLU 46 A . ? GLU 46 A PRO 47 A ? PRO 47 A 5 -0.03 6 GLU 46 A . ? GLU 46 A PRO 47 A ? PRO 47 A 6 0.05 7 GLU 46 A . ? GLU 46 A PRO 47 A ? PRO 47 A 7 0.05 8 GLU 46 A . ? GLU 46 A PRO 47 A ? PRO 47 A 8 -0.05 9 GLU 46 A . ? GLU 46 A PRO 47 A ? PRO 47 A 9 0.05 10 GLU 46 A . ? GLU 46 A PRO 47 A ? PRO 47 A 10 0.01 11 GLU 46 A . ? GLU 46 A PRO 47 A ? PRO 47 A 11 -0.07 12 GLU 46 A . ? GLU 46 A PRO 47 A ? PRO 47 A 12 -0.01 13 GLU 46 A . ? GLU 46 A PRO 47 A ? PRO 47 A 13 -0.05 14 GLU 46 A . ? GLU 46 A PRO 47 A ? PRO 47 A 14 0.03 15 GLU 46 A . ? GLU 46 A PRO 47 A ? PRO 47 A 15 0.03 16 GLU 46 A . ? GLU 46 A PRO 47 A ? PRO 47 A 16 0.06 17 GLU 46 A . ? GLU 46 A PRO 47 A ? PRO 47 A 17 0.01 18 GLU 46 A . ? GLU 46 A PRO 47 A ? PRO 47 A 18 0.06 19 GLU 46 A . ? GLU 46 A PRO 47 A ? PRO 47 A 19 0.01 20 GLU 46 A . ? GLU 46 A PRO 47 A ? PRO 47 A 20 0.01 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 11 ? THR A 14 ? PHE A 11 THR A 14 A 2 SER A 29 ? ALA A 34 ? SER A 29 ALA A 34 A 3 LEU A 39 ? GLU A 40 ? LEU A 39 GLU A 40 B 1 PHE A 62 ? ASP A 65 ? PHE A 62 ASP A 65 B 2 THR A 68 ? ALA A 73 ? THR A 68 ALA A 73 B 3 GLY A 82 ? PHE A 86 ? GLY A 82 PHE A 86 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N PHE A 11 ? N PHE A 11 O LEU A 32 ? O LEU A 32 A 2 3 N ARG A 33 ? N ARG A 33 O GLU A 40 ? O GLU A 40 B 1 2 N GLY A 63 ? N GLY A 63 O SER A 70 ? O SER A 70 B 2 3 N PHE A 69 ? N PHE A 69 O PHE A 86 ? O PHE A 86 # _database_PDB_matrix.entry_id 2DLW _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DLW _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 MET 15 15 15 MET MET A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 TRP 42 42 42 TRP TRP A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 TRP 54 54 54 TRP TRP A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 CYS 77 77 77 CYS CYS A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 GLY 113 113 113 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-10-20 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX Determination method: Author determined ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 59 ? ? -51.99 101.96 2 1 LYS A 66 ? ? -37.06 -31.50 3 1 GLN A 105 ? ? -34.57 -34.24 4 2 PRO A 17 ? ? -69.67 95.14 5 2 ARG A 57 ? ? -34.43 -38.71 6 2 LEU A 59 ? ? -52.03 102.17 7 2 LYS A 106 ? ? -59.53 104.44 8 2 PRO A 110 ? ? -69.69 0.35 9 3 ARG A 57 ? ? -35.05 -35.98 10 3 LEU A 59 ? ? -52.19 109.70 11 5 SER A 21 ? ? -35.61 -38.76 12 5 PRO A 45 ? ? -69.76 -176.41 13 5 ASP A 53 ? ? -51.94 106.45 14 5 LEU A 59 ? ? -52.15 104.23 15 5 ASP A 65 ? ? -97.95 -65.63 16 6 PRO A 45 ? ? -69.70 -177.80 17 6 ASP A 53 ? ? -51.95 106.00 18 6 ARG A 57 ? ? -39.77 -36.58 19 6 LYS A 66 ? ? -38.74 -26.11 20 7 ASP A 53 ? ? -52.01 108.88 21 7 PRO A 110 ? ? -69.78 86.65 22 8 PRO A 45 ? ? -69.77 -177.90 23 8 ASP A 53 ? ? -52.00 108.92 24 8 LYS A 66 ? ? -39.27 -25.51 25 8 PRO A 110 ? ? -69.73 2.37 26 9 ALA A 20 ? ? -94.79 -66.72 27 9 SER A 21 ? ? -37.21 -31.38 28 9 LEU A 59 ? ? -51.96 104.79 29 9 GLU A 81 ? ? -59.60 177.78 30 9 PRO A 110 ? ? -69.80 2.21 31 10 LYS A 9 ? ? -53.16 107.09 32 10 GLU A 19 ? ? -34.25 -39.75 33 10 SER A 21 ? ? -36.38 -32.17 34 10 PRO A 45 ? ? -69.79 0.92 35 10 ARG A 57 ? ? -36.99 -35.71 36 10 LEU A 59 ? ? -52.04 105.77 37 11 ASN A 107 ? ? -56.61 172.88 38 12 ARG A 57 ? ? -34.55 -39.07 39 12 ASP A 65 ? ? -98.01 -67.57 40 12 SER A 79 ? ? -33.29 -37.62 41 13 MET A 15 ? ? -58.10 107.67 42 13 PRO A 17 ? ? -69.79 96.13 43 13 ASP A 53 ? ? -52.00 109.21 44 13 ARG A 57 ? ? -34.52 -32.91 45 13 LEU A 59 ? ? -52.11 102.13 46 14 PRO A 17 ? ? -69.79 99.55 47 14 ARG A 57 ? ? -38.38 -34.97 48 15 ASP A 53 ? ? -52.01 107.49 49 15 LEU A 59 ? ? -53.14 108.08 50 15 PRO A 110 ? ? -69.73 85.57 51 16 ARG A 57 ? ? -37.70 -36.47 52 16 LEU A 59 ? ? -52.09 109.51 53 17 ASP A 53 ? ? -52.04 106.60 54 17 ARG A 57 ? ? -39.28 -37.15 55 17 LEU A 59 ? ? -51.97 102.12 56 17 ARG A 76 ? ? -35.15 -38.31 57 17 PRO A 110 ? ? -69.78 2.75 58 18 PRO A 17 ? ? -69.77 97.89 59 18 ASP A 53 ? ? -51.99 109.58 60 18 LEU A 59 ? ? -52.03 102.58 61 18 SER A 103 ? ? -39.85 -25.64 62 19 GLU A 10 ? ? -53.05 172.33 63 19 ARG A 57 ? ? -35.56 -34.24 64 19 LEU A 59 ? ? -52.35 104.33 65 20 ASP A 53 ? ? -52.02 107.73 66 20 ASP A 65 ? ? -97.97 -68.68 #