data_2DMY # _entry.id 2DMY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DMY pdb_00002dmy 10.2210/pdb2dmy/pdb RCSB RCSB025604 ? ? WWPDB D_1000025604 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk003002567.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DMY _pdbx_database_status.recvd_initial_deposition_date 2006-04-24 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kadirvel, S.' 1 'He, F.' 2 'Muto, Y.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Shirouzu, M.' 6 'Terada, T.' 7 'Yokoyama, S.' 8 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 9 # _citation.id primary _citation.title 'Solution structure of DSRM domain in Spermatid perinuclear RNA-bind protein' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kadirvel, S.' 1 ? primary 'He, F.' 2 ? primary 'Muto, Y.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Shirouzu, M.' 6 ? primary 'Terada, T.' 7 ? primary 'Yokoyama, S.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Spermatid perinuclear RNA-binding protein' _entity.formula_weight 10120.540 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'DSRM domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGRKILDSKAIDLMNALMRLNQIRPGLQYKLLSQSGPVHAPVFTMSVDVDGTTYEASGPSKKTAKLHVAVKVLQA MGYPTGFDADISGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGRKILDSKAIDLMNALMRLNQIRPGLQYKLLSQSGPVHAPVFTMSVDVDGTTYEASGPSKKTAKLHVAVKVLQA MGYPTGFDADISGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk003002567.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 ARG n 1 9 LYS n 1 10 ILE n 1 11 LEU n 1 12 ASP n 1 13 SER n 1 14 LYS n 1 15 ALA n 1 16 ILE n 1 17 ASP n 1 18 LEU n 1 19 MET n 1 20 ASN n 1 21 ALA n 1 22 LEU n 1 23 MET n 1 24 ARG n 1 25 LEU n 1 26 ASN n 1 27 GLN n 1 28 ILE n 1 29 ARG n 1 30 PRO n 1 31 GLY n 1 32 LEU n 1 33 GLN n 1 34 TYR n 1 35 LYS n 1 36 LEU n 1 37 LEU n 1 38 SER n 1 39 GLN n 1 40 SER n 1 41 GLY n 1 42 PRO n 1 43 VAL n 1 44 HIS n 1 45 ALA n 1 46 PRO n 1 47 VAL n 1 48 PHE n 1 49 THR n 1 50 MET n 1 51 SER n 1 52 VAL n 1 53 ASP n 1 54 VAL n 1 55 ASP n 1 56 GLY n 1 57 THR n 1 58 THR n 1 59 TYR n 1 60 GLU n 1 61 ALA n 1 62 SER n 1 63 GLY n 1 64 PRO n 1 65 SER n 1 66 LYS n 1 67 LYS n 1 68 THR n 1 69 ALA n 1 70 LYS n 1 71 LEU n 1 72 HIS n 1 73 VAL n 1 74 ALA n 1 75 VAL n 1 76 LYS n 1 77 VAL n 1 78 LEU n 1 79 GLN n 1 80 ALA n 1 81 MET n 1 82 GLY n 1 83 TYR n 1 84 PRO n 1 85 THR n 1 86 GLY n 1 87 PHE n 1 88 ASP n 1 89 ALA n 1 90 ASP n 1 91 ILE n 1 92 SER n 1 93 GLY n 1 94 PRO n 1 95 SER n 1 96 SER n 1 97 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene STRBP _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cell free synthesis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P051128-11 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9H7V1_HUMAN _struct_ref.pdbx_db_accession Q9H7V1 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 111 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DMY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 91 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9H7V1 _struct_ref_seq.db_align_beg 111 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 194 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 91 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DMY GLY A 1 ? UNP Q9H7V1 ? ? 'cloning artifact' 1 1 1 2DMY SER A 2 ? UNP Q9H7V1 ? ? 'cloning artifact' 2 2 1 2DMY SER A 3 ? UNP Q9H7V1 ? ? 'cloning artifact' 3 3 1 2DMY GLY A 4 ? UNP Q9H7V1 ? ? 'cloning artifact' 4 4 1 2DMY SER A 5 ? UNP Q9H7V1 ? ? 'cloning artifact' 5 5 1 2DMY SER A 6 ? UNP Q9H7V1 ? ? 'cloning artifact' 6 6 1 2DMY GLY A 7 ? UNP Q9H7V1 ? ? 'cloning artifact' 7 7 1 2DMY SER A 92 ? UNP Q9H7V1 ? ? 'cloning artifact' 92 8 1 2DMY GLY A 93 ? UNP Q9H7V1 ? ? 'cloning artifact' 93 9 1 2DMY PRO A 94 ? UNP Q9H7V1 ? ? 'cloning artifact' 94 10 1 2DMY SER A 95 ? UNP Q9H7V1 ? ? 'cloning artifact' 95 11 1 2DMY SER A 96 ? UNP Q9H7V1 ? ? 'cloning artifact' 96 12 1 2DMY GLY A 97 ? UNP Q9H7V1 ? ? 'cloning artifact' 97 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.8mM U-15, 13C; 20mM phosphate buffer NA; 100mM NaCl; 1mM d-DTT; 0.02% NaN3, 90%H2O, 10%D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2DMY _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2DMY _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DMY _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.6 Bruker 1 processing NMRPipe 20031121 Delaglio,F. 2 'data analysis' NMRView 5.0.4 Johnson,B.A. 3 'data analysis' KUJIRA 0.965 Kobayashi,N. 4 'structure solution' CYANA 2.0.17 Guntert,P. 5 refinement CYANA 2.0.17 Guntert,P. 6 # _exptl.entry_id 2DMY _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2DMY _struct.title 'Solution structure of DSRM domain in Spermatid perinuclear RNA-bind protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DMY _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.text ;DSRM domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 20 ? ILE A 28 ? ASN A 20 ILE A 28 1 ? 9 HELX_P HELX_P2 2 LYS A 66 ? MET A 81 ? LYS A 66 MET A 81 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 35 ? SER A 40 ? LYS A 35 SER A 40 A 2 VAL A 47 ? VAL A 54 ? VAL A 47 VAL A 54 A 3 THR A 57 ? GLY A 63 ? THR A 57 GLY A 63 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N SER A 40 ? N SER A 40 O VAL A 47 ? O VAL A 47 A 2 3 N VAL A 54 ? N VAL A 54 O THR A 57 ? O THR A 57 # _database_PDB_matrix.entry_id 2DMY _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DMY _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 MET 19 19 19 MET MET A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 MET 50 50 50 MET MET A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 HIS 72 72 72 HIS HIS A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 MET 81 81 81 MET MET A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 GLY 97 97 97 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-10-24 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX Determination method: Author determined ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 13 ? ? -106.27 46.04 2 1 PRO A 42 ? ? -69.78 -175.51 3 1 ILE A 91 ? ? -35.91 142.23 4 2 ALA A 15 ? ? -62.46 -175.68 5 2 ASP A 17 ? ? -172.92 113.67 6 2 LEU A 18 ? ? -130.03 -69.52 7 2 ALA A 21 ? ? -34.12 -35.28 8 3 SER A 3 ? ? -163.51 114.96 9 3 SER A 5 ? ? -172.14 115.65 10 3 SER A 6 ? ? -169.47 115.45 11 3 LEU A 18 ? ? -122.50 -51.99 12 3 PRO A 42 ? ? -69.78 -174.39 13 3 ALA A 89 ? ? -97.13 45.14 14 4 LYS A 14 ? ? -39.72 147.88 15 4 PRO A 42 ? ? -69.75 -174.53 16 4 ALA A 89 ? ? -92.70 39.46 17 4 ILE A 91 ? ? -49.45 176.07 18 4 SER A 92 ? ? -55.16 108.12 19 4 PRO A 94 ? ? -69.76 -173.85 20 4 SER A 95 ? ? -34.56 122.82 21 5 LYS A 9 ? ? -173.90 144.94 22 5 SER A 13 ? ? -113.85 79.83 23 5 LYS A 14 ? ? -94.53 42.52 24 5 ALA A 89 ? ? -174.85 105.28 25 6 ILE A 10 ? ? -116.06 58.53 26 6 ASP A 12 ? ? -168.80 113.51 27 6 LYS A 14 ? ? -42.23 96.55 28 6 ALA A 15 ? ? -169.19 115.81 29 6 ASP A 17 ? ? -65.80 77.07 30 6 PRO A 42 ? ? -69.78 -178.07 31 6 ILE A 91 ? ? -49.52 -19.64 32 6 SER A 95 ? ? -43.64 109.65 33 7 ALA A 21 ? ? -34.20 -35.47 34 7 PRO A 42 ? ? -69.76 -173.92 35 7 ASP A 90 ? ? -168.55 109.18 36 7 SER A 92 ? ? -171.06 126.74 37 8 ALA A 15 ? ? -173.25 113.40 38 8 ILE A 16 ? ? -37.14 119.80 39 8 ASP A 17 ? ? -59.72 76.47 40 8 PRO A 42 ? ? -69.77 -174.11 41 8 ALA A 89 ? ? -116.49 67.23 42 8 ILE A 91 ? ? -35.93 145.11 43 9 SER A 2 ? ? -126.93 -50.56 44 9 ASP A 12 ? ? -62.53 96.70 45 9 ILE A 16 ? ? -37.53 118.24 46 9 ASP A 17 ? ? -59.55 76.70 47 9 MET A 19 ? ? -49.41 -19.88 48 9 PRO A 42 ? ? -69.72 -173.13 49 9 ALA A 89 ? ? -116.53 51.74 50 9 ASP A 90 ? ? -167.80 106.87 51 9 SER A 96 ? ? -64.37 83.64 52 10 ASP A 12 ? ? 34.52 49.90 53 10 LYS A 14 ? ? -81.07 45.58 54 10 ALA A 15 ? ? -164.71 109.53 55 10 ALA A 89 ? ? -94.81 41.38 56 10 ASP A 90 ? ? -162.17 106.71 57 10 PRO A 94 ? ? -69.76 1.57 58 11 SER A 3 ? ? -46.45 162.44 59 11 ARG A 8 ? ? -101.92 -69.74 60 11 ILE A 10 ? ? -100.15 51.66 61 11 LYS A 14 ? ? -41.56 105.03 62 11 ASP A 17 ? ? -69.74 73.48 63 11 ALA A 21 ? ? -34.02 -38.85 64 11 PRO A 42 ? ? -69.81 -171.84 65 11 ALA A 89 ? ? -114.41 66.15 66 12 SER A 3 ? ? 38.85 50.06 67 12 SER A 6 ? ? -173.19 140.13 68 12 ILE A 16 ? ? -36.33 122.25 69 12 ASP A 17 ? ? -62.48 74.81 70 12 PRO A 42 ? ? -69.74 -172.84 71 12 ILE A 91 ? ? -82.53 40.56 72 13 LYS A 14 ? ? -40.78 102.44 73 13 ASP A 17 ? ? -62.96 74.55 74 13 ALA A 21 ? ? -34.15 -37.46 75 13 LEU A 22 ? ? -60.68 -71.94 76 13 PRO A 42 ? ? -69.79 -176.66 77 13 ASP A 90 ? ? -174.62 112.47 78 14 SER A 13 ? ? -39.98 -29.11 79 14 LYS A 14 ? ? 37.22 45.80 80 14 ASP A 17 ? ? 37.26 43.88 81 14 LEU A 18 ? ? -128.71 -52.60 82 14 ALA A 89 ? ? -94.87 36.84 83 15 SER A 6 ? ? -173.88 115.50 84 15 ARG A 8 ? ? -166.13 114.46 85 15 LEU A 18 ? ? -130.34 -48.30 86 15 PRO A 42 ? ? -69.77 -173.42 87 15 ALA A 89 ? ? -175.04 105.37 88 15 ILE A 91 ? ? -55.61 96.40 89 15 PRO A 94 ? ? -69.85 85.60 90 16 SER A 6 ? ? -129.73 -55.45 91 16 SER A 13 ? ? -99.79 53.12 92 16 LEU A 18 ? ? -128.40 -66.99 93 16 PRO A 42 ? ? -69.79 -173.95 94 16 ALA A 89 ? ? -97.68 41.77 95 16 ILE A 91 ? ? -47.03 151.58 96 17 LEU A 11 ? ? 38.77 53.02 97 17 ASP A 12 ? ? -107.19 44.73 98 17 ALA A 15 ? ? -171.87 112.81 99 17 ASP A 17 ? ? 34.28 41.83 100 17 LEU A 18 ? ? -130.03 -35.47 101 17 PRO A 42 ? ? -69.80 -170.18 102 18 LEU A 18 ? ? -122.23 -70.70 103 18 MET A 19 ? ? -48.00 -19.53 104 18 PRO A 42 ? ? -69.83 -169.70 105 18 ALA A 89 ? ? -109.62 55.23 106 18 ILE A 91 ? ? -37.62 145.19 107 19 SER A 5 ? ? 35.08 42.98 108 19 ILE A 10 ? ? -101.38 49.55 109 19 ASP A 17 ? ? 70.44 38.84 110 19 ASP A 90 ? ? -166.02 113.59 111 19 SER A 95 ? ? -54.74 88.98 112 20 ILE A 10 ? ? -118.53 53.33 113 20 ILE A 16 ? ? -97.16 32.83 114 20 PRO A 42 ? ? -69.81 -170.56 115 20 PHE A 87 ? ? -171.24 131.67 #