data_2DOA # _entry.id 2DOA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DOA pdb_00002doa 10.2210/pdb2doa/pdb RCSB RCSB025648 ? ? WWPDB D_1000025648 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-05-22 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DOA _pdbx_database_status.recvd_initial_deposition_date 2006-04-28 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Saito, K.' 1 'Koshiba, S.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Yokoyama, S.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title 'Solution structure of the helical domain in human Eleven-nineteen lysine-rich leukemia protein ELL' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Saito, K.' 1 ? primary 'Koshiba, S.' 2 ? primary 'Inoue, M.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Yokoyama, S.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'RNA polymerase II elongation factor ELL' _entity.formula_weight 11493.100 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'helical domain, residues 6-98' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Eleven-nineteen lysine-rich leukemia protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGVSQRPFRDRVLHLLALRPYRKAELLLRLQKDGLTQADKDALDGLLQQVANMSAKDGTCTLQDCMYKDVQKDWP GYSEGDQQLLKRVLVRKLSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGVSQRPFRDRVLHLLALRPYRKAELLLRLQKDGLTQADKDALDGLLQQVANMSAKDGTCTLQDCMYKDVQKDWP GYSEGDQQLLKRVLVRKLSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 VAL n 1 9 SER n 1 10 GLN n 1 11 ARG n 1 12 PRO n 1 13 PHE n 1 14 ARG n 1 15 ASP n 1 16 ARG n 1 17 VAL n 1 18 LEU n 1 19 HIS n 1 20 LEU n 1 21 LEU n 1 22 ALA n 1 23 LEU n 1 24 ARG n 1 25 PRO n 1 26 TYR n 1 27 ARG n 1 28 LYS n 1 29 ALA n 1 30 GLU n 1 31 LEU n 1 32 LEU n 1 33 LEU n 1 34 ARG n 1 35 LEU n 1 36 GLN n 1 37 LYS n 1 38 ASP n 1 39 GLY n 1 40 LEU n 1 41 THR n 1 42 GLN n 1 43 ALA n 1 44 ASP n 1 45 LYS n 1 46 ASP n 1 47 ALA n 1 48 LEU n 1 49 ASP n 1 50 GLY n 1 51 LEU n 1 52 LEU n 1 53 GLN n 1 54 GLN n 1 55 VAL n 1 56 ALA n 1 57 ASN n 1 58 MET n 1 59 SER n 1 60 ALA n 1 61 LYS n 1 62 ASP n 1 63 GLY n 1 64 THR n 1 65 CYS n 1 66 THR n 1 67 LEU n 1 68 GLN n 1 69 ASP n 1 70 CYS n 1 71 MET n 1 72 TYR n 1 73 LYS n 1 74 ASP n 1 75 VAL n 1 76 GLN n 1 77 LYS n 1 78 ASP n 1 79 TRP n 1 80 PRO n 1 81 GLY n 1 82 TYR n 1 83 SER n 1 84 GLU n 1 85 GLY n 1 86 ASP n 1 87 GLN n 1 88 GLN n 1 89 LEU n 1 90 LEU n 1 91 LYS n 1 92 ARG n 1 93 VAL n 1 94 LEU n 1 95 VAL n 1 96 ARG n 1 97 LYS n 1 98 LEU n 1 99 SER n 1 100 GLY n 1 101 PRO n 1 102 SER n 1 103 SER n 1 104 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'ELL, C19orf17' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P051025-06 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 MET 58 58 58 MET MET A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 CYS 65 65 65 CYS CYS A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 CYS 70 70 70 CYS CYS A . n A 1 71 MET 71 71 71 MET MET A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 TRP 79 79 79 TRP TRP A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 GLY 104 104 104 GLY GLY A . n # _exptl.entry_id 2DOA _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2DOA _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2DOA _struct.title 'Solution structure of the helical domain in human Eleven-nineteen lysine-rich leukemia protein ELL' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DOA _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text ;elongation factor, C19orf17, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ELL_HUMAN _struct_ref.pdbx_db_accession P55199 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SGVSQRPFRDRVLHLLALRPYRKAELLLRLQKDGLTQADKDALDGLLQQVANMSAKDGTCTLQDCMYKDVQKDWPGYSEG DQQLLKRVLVRKL ; _struct_ref.pdbx_align_begin 200 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DOA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 98 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P55199 _struct_ref_seq.db_align_beg 200 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 292 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 6 _struct_ref_seq.pdbx_auth_seq_align_end 98 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DOA GLY A 1 ? UNP P55199 ? ? 'cloning artifact' 1 1 1 2DOA SER A 2 ? UNP P55199 ? ? 'cloning artifact' 2 2 1 2DOA SER A 3 ? UNP P55199 ? ? 'cloning artifact' 3 3 1 2DOA GLY A 4 ? UNP P55199 ? ? 'cloning artifact' 4 4 1 2DOA SER A 5 ? UNP P55199 ? ? 'cloning artifact' 5 5 1 2DOA SER A 99 ? UNP P55199 ? ? 'cloning artifact' 99 6 1 2DOA GLY A 100 ? UNP P55199 ? ? 'cloning artifact' 100 7 1 2DOA PRO A 101 ? UNP P55199 ? ? 'cloning artifact' 101 8 1 2DOA SER A 102 ? UNP P55199 ? ? 'cloning artifact' 102 9 1 2DOA SER A 103 ? UNP P55199 ? ? 'cloning artifact' 103 10 1 2DOA GLY A 104 ? UNP P55199 ? ? 'cloning artifact' 104 11 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 12 ? ARG A 24 ? PRO A 12 ARG A 24 1 ? 13 HELX_P HELX_P2 2 LYS A 28 ? GLY A 39 ? LYS A 28 GLY A 39 1 ? 12 HELX_P HELX_P3 3 THR A 41 ? VAL A 55 ? THR A 41 VAL A 55 1 ? 15 HELX_P HELX_P4 4 CYS A 70 ? VAL A 75 ? CYS A 70 VAL A 75 5 ? 6 HELX_P HELX_P5 5 GLU A 84 ? LEU A 98 ? GLU A 84 LEU A 98 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 26 ? ARG A 27 ? TYR A 26 ARG A 27 A 2 THR A 64 ? THR A 66 ? THR A 64 THR A 66 A 3 ASN A 57 ? MET A 58 ? ASN A 57 MET A 58 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 26 ? N TYR A 26 O CYS A 65 ? O CYS A 65 A 2 3 O THR A 66 ? O THR A 66 N ASN A 57 ? N ASN A 57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -132.95 -47.31 2 1 PRO A 12 ? ? -59.85 -175.12 3 1 LEU A 23 ? ? -69.02 -71.89 4 1 ALA A 60 ? ? -98.56 30.34 5 1 LYS A 61 ? ? -149.53 -47.13 6 1 GLN A 68 ? ? -67.47 -177.78 7 1 ASP A 74 ? ? -96.84 32.97 8 1 ASP A 78 ? ? -95.67 36.35 9 1 SER A 83 ? ? -148.86 -65.03 10 1 GLU A 84 ? ? -147.52 -67.01 11 1 SER A 99 ? ? 60.29 100.00 12 1 PRO A 101 ? ? -51.98 -177.18 13 2 SER A 2 ? ? 58.58 -172.53 14 2 SER A 3 ? ? 60.51 110.71 15 2 ALA A 60 ? ? -98.10 39.39 16 2 LYS A 61 ? ? -147.24 -50.19 17 2 ASP A 78 ? ? -152.92 31.43 18 2 SER A 83 ? ? -145.64 -49.14 19 2 GLU A 84 ? ? -163.05 -61.73 20 2 SER A 102 ? ? -148.86 -74.47 21 3 SER A 3 ? ? -148.23 47.70 22 3 PRO A 12 ? ? -51.10 -179.27 23 3 ARG A 27 ? ? -65.68 -177.77 24 3 VAL A 55 ? ? -97.14 31.91 25 3 ALA A 60 ? ? -96.59 40.03 26 3 LYS A 61 ? ? -142.55 -71.27 27 3 ASP A 78 ? ? -108.26 40.99 28 3 SER A 83 ? ? -152.64 -49.71 29 3 GLU A 84 ? ? -152.54 -59.65 30 3 LEU A 98 ? ? -69.52 85.10 31 3 PRO A 101 ? ? -51.47 100.90 32 3 SER A 102 ? ? -166.16 -66.68 33 4 SER A 2 ? ? -168.06 -43.34 34 4 SER A 3 ? ? 60.59 -177.08 35 4 SER A 5 ? ? 60.58 -175.25 36 4 LEU A 23 ? ? -70.62 -70.59 37 4 ARG A 27 ? ? -62.55 -177.03 38 4 VAL A 55 ? ? -96.99 35.42 39 4 LYS A 61 ? ? -134.70 -48.57 40 4 ASP A 62 ? ? -127.20 -61.16 41 4 ASP A 78 ? ? -143.65 28.96 42 4 TYR A 82 ? ? -60.46 -173.58 43 4 SER A 83 ? ? -155.96 -52.39 44 4 GLU A 84 ? ? -163.48 -59.18 45 4 SER A 103 ? ? -120.42 -57.19 46 5 SER A 3 ? ? -102.09 78.71 47 5 VAL A 55 ? ? -97.41 35.26 48 5 LYS A 61 ? ? -132.54 -50.33 49 5 ASP A 78 ? ? -99.43 49.28 50 5 SER A 83 ? ? -136.73 -60.79 51 5 GLU A 84 ? ? -154.22 -48.44 52 5 SER A 99 ? ? -66.85 -168.85 53 6 SER A 6 ? ? -170.47 -54.32 54 6 VAL A 55 ? ? -97.62 34.23 55 6 ASP A 62 ? ? -160.02 -53.25 56 6 ASP A 78 ? ? -161.84 35.53 57 6 TYR A 82 ? ? -69.13 -178.70 58 6 SER A 83 ? ? -159.33 -49.30 59 6 GLU A 84 ? ? -164.00 -64.85 60 6 LEU A 98 ? ? -67.21 75.87 61 6 SER A 99 ? ? -151.32 31.24 62 7 SER A 2 ? ? -169.16 -54.20 63 7 SER A 9 ? ? -144.22 -47.63 64 7 LEU A 40 ? ? -159.89 87.74 65 7 VAL A 55 ? ? -96.77 30.20 66 7 ASP A 62 ? ? -123.96 -64.94 67 7 ASP A 74 ? ? -97.08 34.98 68 7 SER A 83 ? ? -161.77 -55.84 69 7 GLU A 84 ? ? -152.91 -50.99 70 8 SER A 5 ? ? -171.70 147.46 71 8 SER A 6 ? ? -168.56 -60.21 72 8 PRO A 12 ? ? -51.14 -178.67 73 8 LEU A 23 ? ? -83.63 -74.95 74 8 ARG A 27 ? ? -60.03 -176.39 75 8 VAL A 55 ? ? -97.02 36.92 76 8 LYS A 61 ? ? -94.14 -76.58 77 8 ASP A 62 ? ? -62.97 -73.52 78 8 ASP A 78 ? ? -95.39 42.52 79 8 SER A 83 ? ? -143.44 -64.41 80 8 GLU A 84 ? ? -149.09 -62.81 81 8 SER A 99 ? ? -142.73 -47.37 82 8 PRO A 101 ? ? -50.55 102.89 83 8 SER A 102 ? ? 61.04 91.60 84 9 SER A 6 ? ? -111.69 60.73 85 9 VAL A 55 ? ? -96.86 37.13 86 9 ASP A 78 ? ? -157.32 32.05 87 9 TYR A 82 ? ? -68.87 -175.49 88 9 SER A 83 ? ? -156.13 -61.89 89 9 GLU A 84 ? ? -146.52 -57.02 90 10 PRO A 12 ? ? -51.17 175.85 91 10 LEU A 23 ? ? -74.41 -73.24 92 10 ARG A 27 ? ? -67.76 -179.75 93 10 VAL A 55 ? ? -97.49 30.32 94 10 LYS A 61 ? ? -135.67 -47.13 95 10 ASP A 74 ? ? -96.74 32.55 96 10 SER A 83 ? ? -144.08 -72.48 97 10 GLU A 84 ? ? -141.90 -61.98 98 10 SER A 99 ? ? 60.18 79.05 99 10 PRO A 101 ? ? -52.25 173.97 100 10 SER A 102 ? ? 62.94 -79.77 101 10 SER A 103 ? ? -145.02 -50.74 102 11 SER A 3 ? ? -97.07 40.74 103 11 SER A 5 ? ? 62.41 91.75 104 11 SER A 6 ? ? -161.00 -45.44 105 11 ARG A 27 ? ? -66.05 -172.53 106 11 ASP A 62 ? ? -159.52 -49.26 107 11 ASP A 78 ? ? -155.31 31.23 108 11 SER A 83 ? ? -141.21 -68.80 109 11 GLU A 84 ? ? -148.69 -50.64 110 12 SER A 6 ? ? -165.85 90.34 111 12 LEU A 40 ? ? -174.99 145.49 112 12 THR A 41 ? ? -153.07 -74.80 113 12 GLN A 42 ? ? -146.84 -45.75 114 12 VAL A 55 ? ? -96.10 33.67 115 12 LYS A 61 ? ? -150.18 -52.84 116 12 ASP A 62 ? ? -103.53 -62.46 117 12 ASP A 78 ? ? -96.24 40.81 118 12 TYR A 82 ? ? -66.48 -172.99 119 12 SER A 83 ? ? -147.40 -56.19 120 12 GLU A 84 ? ? -161.93 -58.67 121 12 SER A 103 ? ? -69.06 78.40 122 13 SER A 6 ? ? -169.77 -58.35 123 13 VAL A 8 ? ? 69.48 -65.73 124 13 LYS A 61 ? ? -151.51 -66.03 125 13 GLN A 68 ? ? -69.19 -176.95 126 13 ASP A 74 ? ? -97.24 30.17 127 13 ASP A 78 ? ? -95.98 40.83 128 13 SER A 83 ? ? -142.83 -68.56 129 13 GLU A 84 ? ? -141.94 -63.98 130 13 PRO A 101 ? ? -67.43 97.87 131 14 SER A 6 ? ? -164.18 -75.47 132 14 VAL A 8 ? ? 69.12 -66.76 133 14 PRO A 12 ? ? -51.34 -178.08 134 14 THR A 41 ? ? -127.79 -75.86 135 14 GLN A 42 ? ? -147.73 -46.07 136 14 VAL A 55 ? ? -97.45 32.54 137 14 ALA A 56 ? ? -173.70 140.94 138 14 LYS A 61 ? ? -163.12 -44.60 139 14 ASP A 78 ? ? -153.34 30.41 140 14 SER A 83 ? ? -155.65 -70.94 141 14 GLU A 84 ? ? -147.30 -47.29 142 14 LYS A 97 ? ? -74.41 -70.52 143 15 SER A 5 ? ? -150.42 73.06 144 15 SER A 6 ? ? -176.88 78.12 145 15 SER A 9 ? ? -141.07 -48.09 146 15 LEU A 40 ? ? -175.62 140.38 147 15 THR A 41 ? ? -150.98 -72.66 148 15 GLN A 42 ? ? -149.88 -45.78 149 15 VAL A 55 ? ? -97.38 33.50 150 15 LYS A 61 ? ? -176.89 -45.49 151 15 ASP A 62 ? ? -124.78 -62.74 152 15 ASP A 78 ? ? -94.45 42.14 153 15 SER A 83 ? ? -146.77 -52.65 154 15 GLU A 84 ? ? -166.41 -54.97 155 15 PRO A 101 ? ? -67.63 -179.57 156 16 SER A 3 ? ? -145.32 -47.45 157 16 PRO A 12 ? ? -61.53 -175.05 158 16 VAL A 55 ? ? -97.59 30.06 159 16 LYS A 61 ? ? -146.31 -47.46 160 16 GLN A 68 ? ? -77.66 -168.75 161 16 ASP A 78 ? ? -164.80 32.78 162 16 SER A 83 ? ? -137.43 -69.39 163 16 GLU A 84 ? ? -149.14 -66.56 164 16 SER A 99 ? ? -137.12 -62.28 165 16 SER A 102 ? ? -145.94 -50.05 166 17 SER A 2 ? ? 67.13 -70.74 167 17 SER A 3 ? ? 59.61 -175.99 168 17 PRO A 12 ? ? -51.50 174.81 169 17 ARG A 27 ? ? -59.22 174.54 170 17 ALA A 60 ? ? -97.32 38.65 171 17 LYS A 61 ? ? -173.22 -51.35 172 17 ASP A 78 ? ? -145.82 30.18 173 17 SER A 83 ? ? -147.67 -61.99 174 17 GLU A 84 ? ? -145.72 -51.95 175 17 SER A 99 ? ? -152.05 31.78 176 17 SER A 103 ? ? 60.14 177.05 177 18 SER A 3 ? ? -120.55 -57.55 178 18 SER A 6 ? ? 61.64 72.36 179 18 VAL A 55 ? ? -97.18 34.11 180 18 ALA A 60 ? ? -98.27 32.53 181 18 LYS A 61 ? ? -130.26 -46.35 182 18 ASP A 78 ? ? -142.44 29.91 183 18 TYR A 82 ? ? -58.99 175.19 184 18 SER A 83 ? ? -151.13 -67.55 185 18 GLU A 84 ? ? -145.63 -62.70 186 18 SER A 99 ? ? -98.16 35.08 187 18 PRO A 101 ? ? -51.76 101.10 188 18 SER A 103 ? ? -168.63 36.10 189 19 SER A 2 ? ? 67.45 -72.26 190 19 SER A 3 ? ? 59.36 92.18 191 19 SER A 5 ? ? 60.34 93.61 192 19 SER A 6 ? ? 60.47 172.56 193 19 PRO A 12 ? ? -51.26 174.49 194 19 VAL A 55 ? ? -97.49 37.62 195 19 LYS A 61 ? ? -136.92 -49.63 196 19 ASP A 78 ? ? -144.11 28.74 197 19 SER A 83 ? ? -140.51 -66.01 198 19 GLU A 84 ? ? -139.13 -65.61 199 19 SER A 103 ? ? -130.54 -62.02 200 20 SER A 6 ? ? -162.95 -44.65 201 20 VAL A 55 ? ? -97.35 30.46 202 20 LYS A 61 ? ? -147.48 -51.48 203 20 ASP A 74 ? ? -96.55 32.84 204 20 ASP A 78 ? ? -140.47 28.29 205 20 SER A 83 ? ? -155.71 -72.82 206 20 GLU A 84 ? ? -148.54 -56.04 207 20 SER A 99 ? ? 60.87 107.93 208 20 SER A 103 ? ? 60.76 -174.26 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 2DOA _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DOA _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1mM protein; 20mM d-Tris-HCL(pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 10% D2O, 90% H2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_refine.entry_id 2DOA _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.6 bruker 1 processing NMRPipe 2002 'Delaglio, F.' 2 'data analysis' NMRView 5 'Johnson, B.A.' 3 'structure solution' CNS 1.1 ? 4 refinement CNS 1.1 ? 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 LEU N N N N 158 LEU CA C N S 159 LEU C C N N 160 LEU O O N N 161 LEU CB C N N 162 LEU CG C N N 163 LEU CD1 C N N 164 LEU CD2 C N N 165 LEU OXT O N N 166 LEU H H N N 167 LEU H2 H N N 168 LEU HA H N N 169 LEU HB2 H N N 170 LEU HB3 H N N 171 LEU HG H N N 172 LEU HD11 H N N 173 LEU HD12 H N N 174 LEU HD13 H N N 175 LEU HD21 H N N 176 LEU HD22 H N N 177 LEU HD23 H N N 178 LEU HXT H N N 179 LYS N N N N 180 LYS CA C N S 181 LYS C C N N 182 LYS O O N N 183 LYS CB C N N 184 LYS CG C N N 185 LYS CD C N N 186 LYS CE C N N 187 LYS NZ N N N 188 LYS OXT O N N 189 LYS H H N N 190 LYS H2 H N N 191 LYS HA H N N 192 LYS HB2 H N N 193 LYS HB3 H N N 194 LYS HG2 H N N 195 LYS HG3 H N N 196 LYS HD2 H N N 197 LYS HD3 H N N 198 LYS HE2 H N N 199 LYS HE3 H N N 200 LYS HZ1 H N N 201 LYS HZ2 H N N 202 LYS HZ3 H N N 203 LYS HXT H N N 204 MET N N N N 205 MET CA C N S 206 MET C C N N 207 MET O O N N 208 MET CB C N N 209 MET CG C N N 210 MET SD S N N 211 MET CE C N N 212 MET OXT O N N 213 MET H H N N 214 MET H2 H N N 215 MET HA H N N 216 MET HB2 H N N 217 MET HB3 H N N 218 MET HG2 H N N 219 MET HG3 H N N 220 MET HE1 H N N 221 MET HE2 H N N 222 MET HE3 H N N 223 MET HXT H N N 224 PHE N N N N 225 PHE CA C N S 226 PHE C C N N 227 PHE O O N N 228 PHE CB C N N 229 PHE CG C Y N 230 PHE CD1 C Y N 231 PHE CD2 C Y N 232 PHE CE1 C Y N 233 PHE CE2 C Y N 234 PHE CZ C Y N 235 PHE OXT O N N 236 PHE H H N N 237 PHE H2 H N N 238 PHE HA H N N 239 PHE HB2 H N N 240 PHE HB3 H N N 241 PHE HD1 H N N 242 PHE HD2 H N N 243 PHE HE1 H N N 244 PHE HE2 H N N 245 PHE HZ H N N 246 PHE HXT H N N 247 PRO N N N N 248 PRO CA C N S 249 PRO C C N N 250 PRO O O N N 251 PRO CB C N N 252 PRO CG C N N 253 PRO CD C N N 254 PRO OXT O N N 255 PRO H H N N 256 PRO HA H N N 257 PRO HB2 H N N 258 PRO HB3 H N N 259 PRO HG2 H N N 260 PRO HG3 H N N 261 PRO HD2 H N N 262 PRO HD3 H N N 263 PRO HXT H N N 264 SER N N N N 265 SER CA C N S 266 SER C C N N 267 SER O O N N 268 SER CB C N N 269 SER OG O N N 270 SER OXT O N N 271 SER H H N N 272 SER H2 H N N 273 SER HA H N N 274 SER HB2 H N N 275 SER HB3 H N N 276 SER HG H N N 277 SER HXT H N N 278 THR N N N N 279 THR CA C N S 280 THR C C N N 281 THR O O N N 282 THR CB C N R 283 THR OG1 O N N 284 THR CG2 C N N 285 THR OXT O N N 286 THR H H N N 287 THR H2 H N N 288 THR HA H N N 289 THR HB H N N 290 THR HG1 H N N 291 THR HG21 H N N 292 THR HG22 H N N 293 THR HG23 H N N 294 THR HXT H N N 295 TRP N N N N 296 TRP CA C N S 297 TRP C C N N 298 TRP O O N N 299 TRP CB C N N 300 TRP CG C Y N 301 TRP CD1 C Y N 302 TRP CD2 C Y N 303 TRP NE1 N Y N 304 TRP CE2 C Y N 305 TRP CE3 C Y N 306 TRP CZ2 C Y N 307 TRP CZ3 C Y N 308 TRP CH2 C Y N 309 TRP OXT O N N 310 TRP H H N N 311 TRP H2 H N N 312 TRP HA H N N 313 TRP HB2 H N N 314 TRP HB3 H N N 315 TRP HD1 H N N 316 TRP HE1 H N N 317 TRP HE3 H N N 318 TRP HZ2 H N N 319 TRP HZ3 H N N 320 TRP HH2 H N N 321 TRP HXT H N N 322 TYR N N N N 323 TYR CA C N S 324 TYR C C N N 325 TYR O O N N 326 TYR CB C N N 327 TYR CG C Y N 328 TYR CD1 C Y N 329 TYR CD2 C Y N 330 TYR CE1 C Y N 331 TYR CE2 C Y N 332 TYR CZ C Y N 333 TYR OH O N N 334 TYR OXT O N N 335 TYR H H N N 336 TYR H2 H N N 337 TYR HA H N N 338 TYR HB2 H N N 339 TYR HB3 H N N 340 TYR HD1 H N N 341 TYR HD2 H N N 342 TYR HE1 H N N 343 TYR HE2 H N N 344 TYR HH H N N 345 TYR HXT H N N 346 VAL N N N N 347 VAL CA C N S 348 VAL C C N N 349 VAL O O N N 350 VAL CB C N N 351 VAL CG1 C N N 352 VAL CG2 C N N 353 VAL OXT O N N 354 VAL H H N N 355 VAL H2 H N N 356 VAL HA H N N 357 VAL HB H N N 358 VAL HG11 H N N 359 VAL HG12 H N N 360 VAL HG13 H N N 361 VAL HG21 H N N 362 VAL HG22 H N N 363 VAL HG23 H N N 364 VAL HXT H N N 365 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 MET N CA sing N N 195 MET N H sing N N 196 MET N H2 sing N N 197 MET CA C sing N N 198 MET CA CB sing N N 199 MET CA HA sing N N 200 MET C O doub N N 201 MET C OXT sing N N 202 MET CB CG sing N N 203 MET CB HB2 sing N N 204 MET CB HB3 sing N N 205 MET CG SD sing N N 206 MET CG HG2 sing N N 207 MET CG HG3 sing N N 208 MET SD CE sing N N 209 MET CE HE1 sing N N 210 MET CE HE2 sing N N 211 MET CE HE3 sing N N 212 MET OXT HXT sing N N 213 PHE N CA sing N N 214 PHE N H sing N N 215 PHE N H2 sing N N 216 PHE CA C sing N N 217 PHE CA CB sing N N 218 PHE CA HA sing N N 219 PHE C O doub N N 220 PHE C OXT sing N N 221 PHE CB CG sing N N 222 PHE CB HB2 sing N N 223 PHE CB HB3 sing N N 224 PHE CG CD1 doub Y N 225 PHE CG CD2 sing Y N 226 PHE CD1 CE1 sing Y N 227 PHE CD1 HD1 sing N N 228 PHE CD2 CE2 doub Y N 229 PHE CD2 HD2 sing N N 230 PHE CE1 CZ doub Y N 231 PHE CE1 HE1 sing N N 232 PHE CE2 CZ sing Y N 233 PHE CE2 HE2 sing N N 234 PHE CZ HZ sing N N 235 PHE OXT HXT sing N N 236 PRO N CA sing N N 237 PRO N CD sing N N 238 PRO N H sing N N 239 PRO CA C sing N N 240 PRO CA CB sing N N 241 PRO CA HA sing N N 242 PRO C O doub N N 243 PRO C OXT sing N N 244 PRO CB CG sing N N 245 PRO CB HB2 sing N N 246 PRO CB HB3 sing N N 247 PRO CG CD sing N N 248 PRO CG HG2 sing N N 249 PRO CG HG3 sing N N 250 PRO CD HD2 sing N N 251 PRO CD HD3 sing N N 252 PRO OXT HXT sing N N 253 SER N CA sing N N 254 SER N H sing N N 255 SER N H2 sing N N 256 SER CA C sing N N 257 SER CA CB sing N N 258 SER CA HA sing N N 259 SER C O doub N N 260 SER C OXT sing N N 261 SER CB OG sing N N 262 SER CB HB2 sing N N 263 SER CB HB3 sing N N 264 SER OG HG sing N N 265 SER OXT HXT sing N N 266 THR N CA sing N N 267 THR N H sing N N 268 THR N H2 sing N N 269 THR CA C sing N N 270 THR CA CB sing N N 271 THR CA HA sing N N 272 THR C O doub N N 273 THR C OXT sing N N 274 THR CB OG1 sing N N 275 THR CB CG2 sing N N 276 THR CB HB sing N N 277 THR OG1 HG1 sing N N 278 THR CG2 HG21 sing N N 279 THR CG2 HG22 sing N N 280 THR CG2 HG23 sing N N 281 THR OXT HXT sing N N 282 TRP N CA sing N N 283 TRP N H sing N N 284 TRP N H2 sing N N 285 TRP CA C sing N N 286 TRP CA CB sing N N 287 TRP CA HA sing N N 288 TRP C O doub N N 289 TRP C OXT sing N N 290 TRP CB CG sing N N 291 TRP CB HB2 sing N N 292 TRP CB HB3 sing N N 293 TRP CG CD1 doub Y N 294 TRP CG CD2 sing Y N 295 TRP CD1 NE1 sing Y N 296 TRP CD1 HD1 sing N N 297 TRP CD2 CE2 doub Y N 298 TRP CD2 CE3 sing Y N 299 TRP NE1 CE2 sing Y N 300 TRP NE1 HE1 sing N N 301 TRP CE2 CZ2 sing Y N 302 TRP CE3 CZ3 doub Y N 303 TRP CE3 HE3 sing N N 304 TRP CZ2 CH2 doub Y N 305 TRP CZ2 HZ2 sing N N 306 TRP CZ3 CH2 sing Y N 307 TRP CZ3 HZ3 sing N N 308 TRP CH2 HH2 sing N N 309 TRP OXT HXT sing N N 310 TYR N CA sing N N 311 TYR N H sing N N 312 TYR N H2 sing N N 313 TYR CA C sing N N 314 TYR CA CB sing N N 315 TYR CA HA sing N N 316 TYR C O doub N N 317 TYR C OXT sing N N 318 TYR CB CG sing N N 319 TYR CB HB2 sing N N 320 TYR CB HB3 sing N N 321 TYR CG CD1 doub Y N 322 TYR CG CD2 sing Y N 323 TYR CD1 CE1 sing Y N 324 TYR CD1 HD1 sing N N 325 TYR CD2 CE2 doub Y N 326 TYR CD2 HD2 sing N N 327 TYR CE1 CZ doub Y N 328 TYR CE1 HE1 sing N N 329 TYR CE2 CZ sing Y N 330 TYR CE2 HE2 sing N N 331 TYR CZ OH sing N N 332 TYR OH HH sing N N 333 TYR OXT HXT sing N N 334 VAL N CA sing N N 335 VAL N H sing N N 336 VAL N H2 sing N N 337 VAL CA C sing N N 338 VAL CA CB sing N N 339 VAL CA HA sing N N 340 VAL C O doub N N 341 VAL C OXT sing N N 342 VAL CB CG1 sing N N 343 VAL CB CG2 sing N N 344 VAL CB HB sing N N 345 VAL CG1 HG11 sing N N 346 VAL CG1 HG12 sing N N 347 VAL CG1 HG13 sing N N 348 VAL CG2 HG21 sing N N 349 VAL CG2 HG22 sing N N 350 VAL CG2 HG23 sing N N 351 VAL OXT HXT sing N N 352 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2DOA _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_