data_2DOB # _entry.id 2DOB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2DOB RCSB RCSB025649 WWPDB D_1000025649 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1N69 'Crystal Structure of Human Saposin B' unspecified PDB 1M12 'NMR Structure of Human Saposin C' unspecified PDB 2GTG 'Crystal Structure of Human Saposin C' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DOB _pdbx_database_status.recvd_initial_deposition_date 2006-04-28 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Prive, G.G.' 1 'Ahn, V.E.' 2 # _citation.id primary _citation.title 'Crystal structures of saposins A and C.' _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 15 _citation.page_first 1849 _citation.page_last 1857 _citation.year 2006 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16823039 _citation.pdbx_database_id_DOI 10.1110/ps.062256606 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Ahn, V.E.' 1 primary 'Leyko, P.' 2 primary 'Alattia, J.R.' 3 primary 'Chen, L.' 4 primary 'Prive, G.G.' 5 # _cell.entry_id 2DOB _cell.length_a 45.680 _cell.length_b 50.040 _cell.length_c 33.820 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2DOB _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Proactivator polypeptide' 9202.181 1 ? ? 'Saposin A, residues 60-140' ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 3 water nat water 18.015 68 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MGSLPCDICKDVVTAAGD(MSE)LKDNATEEEILVYLEKTCDWLPKPN(MSE)SASCKEIVDSYLPVILDIIKGE(MSE) SRPGEVCSALNLCES ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSLPCDICKDVVTAAGDMLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSYLPVILDIIKGEMSRPGEVCSALNL CES ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 LEU n 1 5 PRO n 1 6 CYS n 1 7 ASP n 1 8 ILE n 1 9 CYS n 1 10 LYS n 1 11 ASP n 1 12 VAL n 1 13 VAL n 1 14 THR n 1 15 ALA n 1 16 ALA n 1 17 GLY n 1 18 ASP n 1 19 MSE n 1 20 LEU n 1 21 LYS n 1 22 ASP n 1 23 ASN n 1 24 ALA n 1 25 THR n 1 26 GLU n 1 27 GLU n 1 28 GLU n 1 29 ILE n 1 30 LEU n 1 31 VAL n 1 32 TYR n 1 33 LEU n 1 34 GLU n 1 35 LYS n 1 36 THR n 1 37 CYS n 1 38 ASP n 1 39 TRP n 1 40 LEU n 1 41 PRO n 1 42 LYS n 1 43 PRO n 1 44 ASN n 1 45 MSE n 1 46 SER n 1 47 ALA n 1 48 SER n 1 49 CYS n 1 50 LYS n 1 51 GLU n 1 52 ILE n 1 53 VAL n 1 54 ASP n 1 55 SER n 1 56 TYR n 1 57 LEU n 1 58 PRO n 1 59 VAL n 1 60 ILE n 1 61 LEU n 1 62 ASP n 1 63 ILE n 1 64 ILE n 1 65 LYS n 1 66 GLY n 1 67 GLU n 1 68 MSE n 1 69 SER n 1 70 ARG n 1 71 PRO n 1 72 GLY n 1 73 GLU n 1 74 VAL n 1 75 CYS n 1 76 SER n 1 77 ALA n 1 78 LEU n 1 79 ASN n 1 80 LEU n 1 81 CYS n 1 82 GLU n 1 83 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene PSAP _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3) Codon Plus' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-16 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SAP_HUMAN _struct_ref.pdbx_db_accession P07602 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SLPCDICKDVVTAAGDMLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSYLPVILDIIKGEMSRPGEVCSALNLCE S ; _struct_ref.pdbx_align_begin 60 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DOB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 83 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P07602 _struct_ref_seq.db_align_beg 60 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 140 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 81 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DOB MET A 1 ? UNP P07602 ? ? 'INITIATING METHIONINE' -1 1 1 2DOB GLY A 2 ? UNP P07602 ? ? 'CLONING ARTIFACT' 0 2 1 2DOB MSE A 19 ? UNP P07602 MET 76 'MODIFIED RESIDUE' 17 3 1 2DOB MSE A 45 ? UNP P07602 MET 102 'MODIFIED RESIDUE' 43 4 1 2DOB MSE A 68 ? UNP P07602 MET 125 'MODIFIED RESIDUE' 66 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2DOB _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.13 _exptl_crystal.density_percent_sol 42.24 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6 _exptl_crystal_grow.pdbx_details 'PEG 8K, Calcium Acetate, MES buffer, pH 6, VAPOR DIFFUSION, HANGING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2003-09-04 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.96119 1.0 2 0.9794 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'CHESS BEAMLINE F2' _diffrn_source.pdbx_synchrotron_site CHESS _diffrn_source.pdbx_synchrotron_beamline F2 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.96119, 0.9794' # _reflns.entry_id 2DOB _reflns.observed_criterion_sigma_I -3 _reflns.observed_criterion_sigma_F 0.0 _reflns.d_resolution_low 30.0 _reflns.d_resolution_high 2.0 _reflns.number_obs 5495 _reflns.number_all ? _reflns.percent_possible_obs 98.9 _reflns.pdbx_Rmerge_I_obs 0.089 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate 16.1 _reflns.pdbx_redundancy 11.5 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.0 _reflns_shell.d_res_low 2.07 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs 0.18 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2DOB _refine.ls_number_reflns_obs 5476 _refine.ls_number_reflns_all 5476 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 1804049.90 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 27.18 _refine.ls_d_res_high 2.00 _refine.ls_percent_reflns_obs 97.9 _refine.ls_R_factor_obs 0.219 _refine.ls_R_factor_all 0.219 _refine.ls_R_factor_R_work 0.218 _refine.ls_R_factor_R_free 0.267 _refine.ls_R_factor_R_free_error 0.010 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 12.4 _refine.ls_number_reflns_R_free 678 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 25.7 _refine.aniso_B[1][1] -2.18 _refine.aniso_B[2][2] 0.00 _refine.aniso_B[3][3] 2.18 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.354389 _refine.solvent_model_param_bsol 48.0438 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2DOB _refine_analyze.Luzzati_coordinate_error_obs 0.23 _refine_analyze.Luzzati_sigma_a_obs -0.06 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.30 _refine_analyze.Luzzati_sigma_a_free 0.10 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 617 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 68 _refine_hist.number_atoms_total 686 _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 27.18 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.008 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.4 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 18.5 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 1.11 ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.92 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 3.03 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 2.94 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 4.52 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.00 _refine_ls_shell.d_res_low 2.13 _refine_ls_shell.number_reflns_R_work 773 _refine_ls_shell.R_factor_R_work 0.192 _refine_ls_shell.percent_reflns_obs 98.1 _refine_ls_shell.R_factor_R_free 0.238 _refine_ls_shell.R_factor_R_free_error 0.024 _refine_ls_shell.percent_reflns_R_free 10.9 _refine_ls_shell.number_reflns_R_free 95 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 2 water_rep.param water.top 'X-RAY DIFFRACTION' 3 ion.param ion.top 'X-RAY DIFFRACTION' # _struct.entry_id 2DOB _struct.title 'Crystal Structure of Human Saposin A' _struct.pdbx_descriptor 'Proactivator polypeptide, Saposin A' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DOB _struct_keywords.pdbx_keywords 'LIPID BINDING PROTEIN' _struct_keywords.text 'saposin, sphingolipid activator protein, lipid-binding protein, LIPID BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 3 ? ASP A 22 ? SER A 1 ASP A 20 1 ? 20 HELX_P HELX_P2 2 THR A 25 ? CYS A 37 ? THR A 23 CYS A 35 1 ? 13 HELX_P HELX_P3 3 ASP A 38 ? LEU A 40 ? ASP A 36 LEU A 38 5 ? 3 HELX_P HELX_P4 4 LYS A 42 ? ILE A 64 ? LYS A 40 ILE A 62 1 ? 23 HELX_P HELX_P5 5 ARG A 70 ? LEU A 78 ? ARG A 68 LEU A 76 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 81 SG ? ? A CYS 4 A CYS 79 1_555 ? ? ? ? ? ? ? 2.044 ? disulf2 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 75 SG ? ? A CYS 7 A CYS 73 1_555 ? ? ? ? ? ? ? 2.039 ? disulf3 disulf ? ? A CYS 37 SG ? ? ? 1_555 A CYS 49 SG ? ? A CYS 35 A CYS 47 1_555 ? ? ? ? ? ? ? 2.043 ? covale1 covale ? ? A ASP 18 C ? ? ? 1_555 A MSE 19 N ? ? A ASP 16 A MSE 17 1_555 ? ? ? ? ? ? ? 1.329 ? covale2 covale ? ? A MSE 19 C ? ? ? 1_555 A LEU 20 N ? ? A MSE 17 A LEU 18 1_555 ? ? ? ? ? ? ? 1.329 ? covale3 covale ? ? A ASN 44 C ? ? ? 1_555 A MSE 45 N ? ? A ASN 42 A MSE 43 1_555 ? ? ? ? ? ? ? 1.333 ? covale4 covale ? ? A MSE 45 C ? ? ? 1_555 A SER 46 N ? ? A MSE 43 A SER 44 1_555 ? ? ? ? ? ? ? 1.330 ? covale5 covale ? ? A GLU 67 C ? ? ? 1_555 A MSE 68 N ? ? A GLU 65 A MSE 66 1_555 ? ? ? ? ? ? ? 1.323 ? covale6 covale ? ? A MSE 68 C ? ? ? 1_555 A SER 69 N ? ? A MSE 66 A SER 67 1_555 ? ? ? ? ? ? ? 1.335 ? metalc1 metalc ? ? B CA . CA ? ? ? 1_555 C HOH . O ? ? A CA 601 A HOH 506 1_555 ? ? ? ? ? ? ? 2.524 ? metalc2 metalc ? ? B CA . CA ? ? ? 1_555 C HOH . O ? ? A CA 601 A HOH 503 1_555 ? ? ? ? ? ? ? 2.577 ? metalc3 metalc ? ? B CA . CA ? ? ? 1_555 C HOH . O ? ? A CA 601 A HOH 513 1_555 ? ? ? ? ? ? ? 2.506 ? metalc4 metalc ? ? B CA . CA ? ? ? 1_555 A ASP 38 O ? ? A CA 601 A ASP 36 1_555 ? ? ? ? ? ? ? 2.487 ? metalc5 metalc ? ? B CA . CA ? ? ? 1_555 A ASP 11 OD1 ? ? A CA 601 A ASP 9 2_755 ? ? ? ? ? ? ? 2.624 ? metalc6 metalc ? ? B CA . CA ? ? ? 1_555 C HOH . O ? ? A CA 601 A HOH 502 2_755 ? ? ? ? ? ? ? 2.540 ? metalc7 metalc ? ? B CA . CA ? ? ? 1_555 A ASP 11 OD2 ? ? A CA 601 A ASP 9 2_755 ? ? ? ? ? ? ? 2.567 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? metalc ? ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'BINDING SITE FOR RESIDUE CA A 601' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ASP A 11 ? ASP A 9 . ? 2_755 ? 2 AC1 6 ASP A 38 ? ASP A 36 . ? 1_555 ? 3 AC1 6 HOH C . ? HOH A 502 . ? 2_755 ? 4 AC1 6 HOH C . ? HOH A 503 . ? 1_555 ? 5 AC1 6 HOH C . ? HOH A 506 . ? 1_555 ? 6 AC1 6 HOH C . ? HOH A 513 . ? 1_555 ? # _database_PDB_matrix.entry_id 2DOB _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DOB _atom_sites.fract_transf_matrix[1][1] 0.021891 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019984 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.029568 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -1 ? ? ? A . n A 1 2 GLY 2 0 0 GLY GLY A . n A 1 3 SER 3 1 1 SER SER A . n A 1 4 LEU 4 2 2 LEU LEU A . n A 1 5 PRO 5 3 3 PRO PRO A . n A 1 6 CYS 6 4 4 CYS CYS A . n A 1 7 ASP 7 5 5 ASP ASP A . n A 1 8 ILE 8 6 6 ILE ILE A . n A 1 9 CYS 9 7 7 CYS CYS A . n A 1 10 LYS 10 8 8 LYS LYS A . n A 1 11 ASP 11 9 9 ASP ASP A . n A 1 12 VAL 12 10 10 VAL VAL A . n A 1 13 VAL 13 11 11 VAL VAL A . n A 1 14 THR 14 12 12 THR THR A . n A 1 15 ALA 15 13 13 ALA ALA A . n A 1 16 ALA 16 14 14 ALA ALA A . n A 1 17 GLY 17 15 15 GLY GLY A . n A 1 18 ASP 18 16 16 ASP ASP A . n A 1 19 MSE 19 17 17 MSE MSE A . n A 1 20 LEU 20 18 18 LEU LEU A . n A 1 21 LYS 21 19 19 LYS LYS A . n A 1 22 ASP 22 20 20 ASP ASP A . n A 1 23 ASN 23 21 21 ASN ASN A . n A 1 24 ALA 24 22 22 ALA ALA A . n A 1 25 THR 25 23 23 THR THR A . n A 1 26 GLU 26 24 24 GLU GLU A . n A 1 27 GLU 27 25 25 GLU GLU A . n A 1 28 GLU 28 26 26 GLU GLU A . n A 1 29 ILE 29 27 27 ILE ILE A . n A 1 30 LEU 30 28 28 LEU LEU A . n A 1 31 VAL 31 29 29 VAL VAL A . n A 1 32 TYR 32 30 30 TYR TYR A . n A 1 33 LEU 33 31 31 LEU LEU A . n A 1 34 GLU 34 32 32 GLU GLU A . n A 1 35 LYS 35 33 33 LYS LYS A . n A 1 36 THR 36 34 34 THR THR A . n A 1 37 CYS 37 35 35 CYS CYS A . n A 1 38 ASP 38 36 36 ASP ASP A . n A 1 39 TRP 39 37 37 TRP TRP A . n A 1 40 LEU 40 38 38 LEU LEU A . n A 1 41 PRO 41 39 39 PRO PRO A . n A 1 42 LYS 42 40 40 LYS LYS A . n A 1 43 PRO 43 41 41 PRO PRO A . n A 1 44 ASN 44 42 42 ASN ASN A . n A 1 45 MSE 45 43 43 MSE MSE A . n A 1 46 SER 46 44 44 SER SER A . n A 1 47 ALA 47 45 45 ALA ALA A . n A 1 48 SER 48 46 46 SER SER A . n A 1 49 CYS 49 47 47 CYS CYS A . n A 1 50 LYS 50 48 48 LYS LYS A . n A 1 51 GLU 51 49 49 GLU GLU A . n A 1 52 ILE 52 50 50 ILE ILE A . n A 1 53 VAL 53 51 51 VAL VAL A . n A 1 54 ASP 54 52 52 ASP ASP A . n A 1 55 SER 55 53 53 SER SER A . n A 1 56 TYR 56 54 54 TYR TYR A . n A 1 57 LEU 57 55 55 LEU LEU A . n A 1 58 PRO 58 56 56 PRO PRO A . n A 1 59 VAL 59 57 57 VAL VAL A . n A 1 60 ILE 60 58 58 ILE ILE A . n A 1 61 LEU 61 59 59 LEU LEU A . n A 1 62 ASP 62 60 60 ASP ASP A . n A 1 63 ILE 63 61 61 ILE ILE A . n A 1 64 ILE 64 62 62 ILE ILE A . n A 1 65 LYS 65 63 63 LYS LYS A . n A 1 66 GLY 66 64 64 GLY GLY A . n A 1 67 GLU 67 65 65 GLU GLU A . n A 1 68 MSE 68 66 66 MSE MSE A . n A 1 69 SER 69 67 67 SER SER A . n A 1 70 ARG 70 68 68 ARG ARG A . n A 1 71 PRO 71 69 69 PRO PRO A . n A 1 72 GLY 72 70 70 GLY GLY A . n A 1 73 GLU 73 71 71 GLU GLU A . n A 1 74 VAL 74 72 72 VAL VAL A . n A 1 75 CYS 75 73 73 CYS CYS A . n A 1 76 SER 76 74 74 SER SER A . n A 1 77 ALA 77 75 75 ALA ALA A . n A 1 78 LEU 78 76 76 LEU LEU A . n A 1 79 ASN 79 77 77 ASN ASN A . n A 1 80 LEU 80 78 78 LEU LEU A . n A 1 81 CYS 81 79 79 CYS CYS A . n A 1 82 GLU 82 80 80 GLU GLU A . n A 1 83 SER 83 81 81 SER SER A . n # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 19 A MSE 17 ? MET SELENOMETHIONINE 2 A MSE 45 A MSE 43 ? MET SELENOMETHIONINE 3 A MSE 68 A MSE 66 ? MET SELENOMETHIONINE # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PQS monomeric 1 2 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C 2 1,2 A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 1560 ? 2 MORE -33 ? 2 'SSA (A^2)' 8820 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_755 -x+2,-y,z -1.0000000000 0.0000000000 0.0000000000 91.3600000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? C HOH . ? A HOH 506 ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O ? C HOH . ? A HOH 503 ? 1_555 73.6 ? 2 O ? C HOH . ? A HOH 506 ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O ? C HOH . ? A HOH 513 ? 1_555 157.0 ? 3 O ? C HOH . ? A HOH 503 ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O ? C HOH . ? A HOH 513 ? 1_555 85.3 ? 4 O ? C HOH . ? A HOH 506 ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O ? A ASP 38 ? A ASP 36 ? 1_555 96.6 ? 5 O ? C HOH . ? A HOH 503 ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O ? A ASP 38 ? A ASP 36 ? 1_555 78.6 ? 6 O ? C HOH . ? A HOH 513 ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O ? A ASP 38 ? A ASP 36 ? 1_555 87.8 ? 7 O ? C HOH . ? A HOH 506 ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 OD1 ? A ASP 11 ? A ASP 9 ? 2_755 77.2 ? 8 O ? C HOH . ? A HOH 503 ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 OD1 ? A ASP 11 ? A ASP 9 ? 2_755 150.2 ? 9 O ? C HOH . ? A HOH 513 ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 OD1 ? A ASP 11 ? A ASP 9 ? 2_755 124.4 ? 10 O ? A ASP 38 ? A ASP 36 ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 OD1 ? A ASP 11 ? A ASP 9 ? 2_755 98.9 ? 11 O ? C HOH . ? A HOH 506 ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O ? C HOH . ? A HOH 502 ? 2_755 81.3 ? 12 O ? C HOH . ? A HOH 503 ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O ? C HOH . ? A HOH 502 ? 2_755 102.2 ? 13 O ? C HOH . ? A HOH 513 ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O ? C HOH . ? A HOH 502 ? 2_755 94.7 ? 14 O ? A ASP 38 ? A ASP 36 ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O ? C HOH . ? A HOH 502 ? 2_755 177.4 ? 15 OD1 ? A ASP 11 ? A ASP 9 ? 2_755 CA ? B CA . ? A CA 601 ? 1_555 O ? C HOH . ? A HOH 502 ? 2_755 79.1 ? 16 O ? C HOH . ? A HOH 506 ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 OD2 ? A ASP 11 ? A ASP 9 ? 2_755 127.3 ? 17 O ? C HOH . ? A HOH 503 ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 OD2 ? A ASP 11 ? A ASP 9 ? 2_755 159.0 ? 18 O ? C HOH . ? A HOH 513 ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 OD2 ? A ASP 11 ? A ASP 9 ? 2_755 74.2 ? 19 O ? A ASP 38 ? A ASP 36 ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 OD2 ? A ASP 11 ? A ASP 9 ? 2_755 95.6 ? 20 OD1 ? A ASP 11 ? A ASP 9 ? 2_755 CA ? B CA . ? A CA 601 ? 1_555 OD2 ? A ASP 11 ? A ASP 9 ? 2_755 50.3 ? 21 O ? C HOH . ? A HOH 502 ? 2_755 CA ? B CA . ? A CA 601 ? 1_555 OD2 ? A ASP 11 ? A ASP 9 ? 2_755 84.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-07-25 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 ADSC 'data collection' . ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 SOLVE phasing . ? 5 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 567 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 567 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_755 _pdbx_validate_symm_contact.dist 1.77 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id SER _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 1 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 69.12 _pdbx_validate_torsion.psi -100.19 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id TYR _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 30 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.080 _pdbx_validate_planes.type 'SIDE CHAIN' # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id MET _pdbx_unobs_or_zero_occ_residues.auth_seq_id -1 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id MET _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 601 601 CA CA A . C 3 HOH 1 501 501 HOH HOH A . C 3 HOH 2 502 502 HOH HOH A . C 3 HOH 3 503 503 HOH HOH A . C 3 HOH 4 504 504 HOH HOH A . C 3 HOH 5 505 505 HOH HOH A . C 3 HOH 6 506 506 HOH HOH A . C 3 HOH 7 507 507 HOH HOH A . C 3 HOH 8 508 508 HOH HOH A . C 3 HOH 9 509 509 HOH HOH A . C 3 HOH 10 510 510 HOH HOH A . C 3 HOH 11 511 511 HOH HOH A . C 3 HOH 12 512 512 HOH HOH A . C 3 HOH 13 513 513 HOH HOH A . C 3 HOH 14 514 514 HOH HOH A . C 3 HOH 15 515 515 HOH HOH A . C 3 HOH 16 516 516 HOH HOH A . C 3 HOH 17 517 517 HOH HOH A . C 3 HOH 18 518 518 HOH HOH A . C 3 HOH 19 519 519 HOH HOH A . C 3 HOH 20 520 520 HOH HOH A . C 3 HOH 21 521 521 HOH HOH A . C 3 HOH 22 522 522 HOH HOH A . C 3 HOH 23 523 523 HOH HOH A . C 3 HOH 24 524 524 HOH HOH A . C 3 HOH 25 525 525 HOH HOH A . C 3 HOH 26 526 526 HOH HOH A . C 3 HOH 27 527 527 HOH HOH A . C 3 HOH 28 528 528 HOH HOH A . C 3 HOH 29 529 529 HOH HOH A . C 3 HOH 30 530 530 HOH HOH A . C 3 HOH 31 531 531 HOH HOH A . C 3 HOH 32 532 532 HOH HOH A . C 3 HOH 33 533 533 HOH HOH A . C 3 HOH 34 534 534 HOH HOH A . C 3 HOH 35 535 535 HOH HOH A . C 3 HOH 36 536 536 HOH HOH A . C 3 HOH 37 537 537 HOH HOH A . C 3 HOH 38 538 538 HOH HOH A . C 3 HOH 39 539 539 HOH HOH A . C 3 HOH 40 540 540 HOH HOH A . C 3 HOH 41 541 541 HOH HOH A . C 3 HOH 42 542 542 HOH HOH A . C 3 HOH 43 543 543 HOH HOH A . C 3 HOH 44 544 544 HOH HOH A . C 3 HOH 45 545 545 HOH HOH A . C 3 HOH 46 546 546 HOH HOH A . C 3 HOH 47 547 547 HOH HOH A . C 3 HOH 48 548 548 HOH HOH A . C 3 HOH 49 549 549 HOH HOH A . C 3 HOH 50 550 550 HOH HOH A . C 3 HOH 51 551 551 HOH HOH A . C 3 HOH 52 552 552 HOH HOH A . C 3 HOH 53 553 553 HOH HOH A . C 3 HOH 54 554 554 HOH HOH A . C 3 HOH 55 555 555 HOH HOH A . C 3 HOH 56 556 556 HOH HOH A . C 3 HOH 57 557 557 HOH HOH A . C 3 HOH 58 558 558 HOH HOH A . C 3 HOH 59 559 559 HOH HOH A . C 3 HOH 60 560 560 HOH HOH A . C 3 HOH 61 561 561 HOH HOH A . C 3 HOH 62 562 562 HOH HOH A . C 3 HOH 63 563 563 HOH HOH A . C 3 HOH 64 564 564 HOH HOH A . C 3 HOH 65 565 565 HOH HOH A . C 3 HOH 66 567 567 HOH HOH A . C 3 HOH 67 568 568 HOH HOH A . C 3 HOH 68 569 569 HOH HOH A . #