data_2DOS # _entry.id 2DOS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2DOS RCSB RCSB025665 WWPDB D_1000025665 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DOS _pdbx_database_status.recvd_initial_deposition_date 2006-05-03 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # _audit_author.name 'Sumiyoshi, A.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'Mode of substrate recognition by the Josephin domain of ataxin-3, which has an endo-type deubiquitinase activity.' _citation.journal_abbrev 'Febs Lett.' _citation.journal_volume 588 _citation.page_first 4422 _citation.page_last 4430 _citation.year 2014 _citation.journal_id_ASTM FEBLAL _citation.country NE _citation.journal_id_ISSN 0014-5793 _citation.journal_id_CSD 0165 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25448680 _citation.pdbx_database_id_DOI 10.1016/j.febslet.2014.10.013 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Satoh, T.' 1 primary 'Sumiyoshi, A.' 2 primary 'Yagi-Utsumi, M.' 3 primary 'Sakata, E.' 4 primary 'Sasakawa, H.' 5 primary 'Kurimoto, E.' 6 primary 'Yamaguchi, Y.' 7 primary 'Li, W.' 8 primary 'Joazeiro, C.A.' 9 primary 'Hirokawa, T.' 10 primary 'Kato, K.' 11 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Ataxin-3 _entity.formula_weight 20162.674 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.4.22.- _entity.pdbx_mutation ? _entity.pdbx_fragment 'Josephin domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Machado-Joseph disease protein 1, Spinocerebellar ataxia type 3 protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPLGSMESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFF SIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQL QQEGYSIFVVKGDLPD ; _entity_poly.pdbx_seq_one_letter_code_can ;GPLGSMESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFF SIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQL QQEGYSIFVVKGDLPD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 MET n 1 7 GLU n 1 8 SER n 1 9 ILE n 1 10 PHE n 1 11 HIS n 1 12 GLU n 1 13 LYS n 1 14 GLN n 1 15 GLU n 1 16 GLY n 1 17 SER n 1 18 LEU n 1 19 CYS n 1 20 ALA n 1 21 GLN n 1 22 HIS n 1 23 CYS n 1 24 LEU n 1 25 ASN n 1 26 ASN n 1 27 LEU n 1 28 LEU n 1 29 GLN n 1 30 GLY n 1 31 GLU n 1 32 TYR n 1 33 PHE n 1 34 SER n 1 35 PRO n 1 36 VAL n 1 37 GLU n 1 38 LEU n 1 39 SER n 1 40 SER n 1 41 ILE n 1 42 ALA n 1 43 HIS n 1 44 GLN n 1 45 LEU n 1 46 ASP n 1 47 GLU n 1 48 GLU n 1 49 GLU n 1 50 ARG n 1 51 MET n 1 52 ARG n 1 53 MET n 1 54 ALA n 1 55 GLU n 1 56 GLY n 1 57 GLY n 1 58 VAL n 1 59 THR n 1 60 SER n 1 61 GLU n 1 62 ASP n 1 63 TYR n 1 64 ARG n 1 65 THR n 1 66 PHE n 1 67 LEU n 1 68 GLN n 1 69 GLN n 1 70 PRO n 1 71 SER n 1 72 GLY n 1 73 ASN n 1 74 MET n 1 75 ASP n 1 76 ASP n 1 77 SER n 1 78 GLY n 1 79 PHE n 1 80 PHE n 1 81 SER n 1 82 ILE n 1 83 GLN n 1 84 VAL n 1 85 ILE n 1 86 SER n 1 87 ASN n 1 88 ALA n 1 89 LEU n 1 90 LYS n 1 91 VAL n 1 92 TRP n 1 93 GLY n 1 94 LEU n 1 95 GLU n 1 96 LEU n 1 97 ILE n 1 98 LEU n 1 99 PHE n 1 100 ASN n 1 101 SER n 1 102 PRO n 1 103 GLU n 1 104 TYR n 1 105 GLN n 1 106 ARG n 1 107 LEU n 1 108 ARG n 1 109 ILE n 1 110 ASP n 1 111 PRO n 1 112 ILE n 1 113 ASN n 1 114 GLU n 1 115 ARG n 1 116 SER n 1 117 PHE n 1 118 ILE n 1 119 CYS n 1 120 ASN n 1 121 TYR n 1 122 LYS n 1 123 GLU n 1 124 HIS n 1 125 TRP n 1 126 PHE n 1 127 THR n 1 128 VAL n 1 129 ARG n 1 130 LYS n 1 131 LEU n 1 132 GLY n 1 133 LYS n 1 134 GLN n 1 135 TRP n 1 136 PHE n 1 137 ASN n 1 138 LEU n 1 139 ASN n 1 140 SER n 1 141 LEU n 1 142 LEU n 1 143 THR n 1 144 GLY n 1 145 PRO n 1 146 GLU n 1 147 LEU n 1 148 ILE n 1 149 SER n 1 150 ASP n 1 151 THR n 1 152 TYR n 1 153 LEU n 1 154 ALA n 1 155 LEU n 1 156 PHE n 1 157 LEU n 1 158 ALA n 1 159 GLN n 1 160 LEU n 1 161 GLN n 1 162 GLN n 1 163 GLU n 1 164 GLY n 1 165 TYR n 1 166 SER n 1 167 ILE n 1 168 PHE n 1 169 VAL n 1 170 VAL n 1 171 LYS n 1 172 GLY n 1 173 ASP n 1 174 LEU n 1 175 PRO n 1 176 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX6P-1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ATX3_HUMAN _struct_ref.pdbx_db_accession P54252 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVI SNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGY SIFVVKGDLPD ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DOS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 176 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P54252 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 171 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 171 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DOS GLY A 1 ? UNP P54252 ? ? 'CLONING ARTIFACT' -4 1 1 2DOS PRO A 2 ? UNP P54252 ? ? 'CLONING ARTIFACT' -3 2 1 2DOS LEU A 3 ? UNP P54252 ? ? 'CLONING ARTIFACT' -2 3 1 2DOS GLY A 4 ? UNP P54252 ? ? 'CLONING ARTIFACT' -1 4 1 2DOS SER A 5 ? UNP P54252 ? ? 'CLONING ARTIFACT' 0 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 3 1 '2D NOESY' 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '10mM Sodium phosphate buffer' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1.2mM Josephin domain U-15N,13C; 10mM Sodium phosphate buffer; 90% H2O, 10% D2O' '90% H2O/10% D2O' 2 '1.2mM Josephin domain U-15N,13C; 10mM Sodium phosphate buffer; 99% D2O' '99% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 ECA JEOL 920 ? 2 Avance Bruker 600 ? 3 DMX Bruker 500 ? # _pdbx_nmr_refine.entry_id 2DOS _pdbx_nmr_refine.method 'distance geometry, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2DOS _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DOS _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XWINNMR 2.6 ? 1 processing NMRPipe 2.3 Delaglio 2 'structure solution' CYANA 2.1 Guntert 3 collection DELTA 4.3.3 ? 4 refinement CYANA 2.1 Guntert 5 # _exptl.entry_id 2DOS _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2DOS _struct.title ;Structural basis for the recognition of Lys48-linked polyubiquitin chain by the Josephin domain of ataxin-3, a putative deubiquitinating enzyme ; _struct.pdbx_descriptor 'Ataxin-3 (E.C.3.4.22.-)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DOS _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'Deubiquitinating enzyme, HYDROLASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 19 ? LEU A 28 ? CYS A 14 LEU A 23 1 ? 10 HELX_P HELX_P2 2 SER A 34 ? GLU A 55 ? SER A 29 GLU A 50 1 ? 22 HELX_P HELX_P3 3 THR A 59 ? GLN A 68 ? THR A 54 GLN A 63 1 ? 10 HELX_P HELX_P4 4 SER A 81 ? VAL A 91 ? SER A 76 VAL A 86 1 ? 11 HELX_P HELX_P5 5 SER A 101 ? ARG A 108 ? SER A 96 ARG A 103 1 ? 8 HELX_P HELX_P6 6 SER A 149 ? GLY A 164 ? SER A 144 GLY A 159 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 95 ? LEU A 98 ? GLU A 90 LEU A 93 A 2 SER A 166 ? LYS A 171 ? SER A 161 LYS A 166 A 3 SER A 116 ? TYR A 121 ? SER A 111 TYR A 116 A 4 HIS A 124 ? LEU A 131 ? HIS A 119 LEU A 126 A 5 GLN A 134 ? LEU A 138 ? GLN A 129 LEU A 133 A 6 GLU A 146 ? ILE A 148 ? GLU A 141 ILE A 143 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLU A 95 ? N GLU A 90 O LYS A 171 ? O LYS A 166 A 2 3 O PHE A 168 ? O PHE A 163 N ILE A 118 ? N ILE A 113 A 3 4 N PHE A 117 ? N PHE A 112 O VAL A 128 ? O VAL A 123 A 4 5 N ARG A 129 ? N ARG A 124 O PHE A 136 ? O PHE A 131 A 5 6 N TRP A 135 ? N TRP A 130 O ILE A 148 ? O ILE A 143 # _database_PDB_matrix.entry_id 2DOS _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DOS _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -4 ? ? ? A . n A 1 2 PRO 2 -3 ? ? ? A . n A 1 3 LEU 3 -2 ? ? ? A . n A 1 4 GLY 4 -1 ? ? ? A . n A 1 5 SER 5 0 ? ? ? A . n A 1 6 MET 6 1 1 MET MET A . n A 1 7 GLU 7 2 2 GLU GLU A . n A 1 8 SER 8 3 3 SER SER A . n A 1 9 ILE 9 4 4 ILE ILE A . n A 1 10 PHE 10 5 5 PHE PHE A . n A 1 11 HIS 11 6 6 HIS HIS A . n A 1 12 GLU 12 7 7 GLU GLU A . n A 1 13 LYS 13 8 8 LYS LYS A . n A 1 14 GLN 14 9 9 GLN GLN A . n A 1 15 GLU 15 10 10 GLU GLU A . n A 1 16 GLY 16 11 11 GLY GLY A . n A 1 17 SER 17 12 12 SER SER A . n A 1 18 LEU 18 13 13 LEU LEU A . n A 1 19 CYS 19 14 14 CYS CYS A . n A 1 20 ALA 20 15 15 ALA ALA A . n A 1 21 GLN 21 16 16 GLN GLN A . n A 1 22 HIS 22 17 17 HIS HIS A . n A 1 23 CYS 23 18 18 CYS CYS A . n A 1 24 LEU 24 19 19 LEU LEU A . n A 1 25 ASN 25 20 20 ASN ASN A . n A 1 26 ASN 26 21 21 ASN ASN A . n A 1 27 LEU 27 22 22 LEU LEU A . n A 1 28 LEU 28 23 23 LEU LEU A . n A 1 29 GLN 29 24 24 GLN GLN A . n A 1 30 GLY 30 25 25 GLY GLY A . n A 1 31 GLU 31 26 26 GLU GLU A . n A 1 32 TYR 32 27 27 TYR TYR A . n A 1 33 PHE 33 28 28 PHE PHE A . n A 1 34 SER 34 29 29 SER SER A . n A 1 35 PRO 35 30 30 PRO PRO A . n A 1 36 VAL 36 31 31 VAL VAL A . n A 1 37 GLU 37 32 32 GLU GLU A . n A 1 38 LEU 38 33 33 LEU LEU A . n A 1 39 SER 39 34 34 SER SER A . n A 1 40 SER 40 35 35 SER SER A . n A 1 41 ILE 41 36 36 ILE ILE A . n A 1 42 ALA 42 37 37 ALA ALA A . n A 1 43 HIS 43 38 38 HIS HIS A . n A 1 44 GLN 44 39 39 GLN GLN A . n A 1 45 LEU 45 40 40 LEU LEU A . n A 1 46 ASP 46 41 41 ASP ASP A . n A 1 47 GLU 47 42 42 GLU GLU A . n A 1 48 GLU 48 43 43 GLU GLU A . n A 1 49 GLU 49 44 44 GLU GLU A . n A 1 50 ARG 50 45 45 ARG ARG A . n A 1 51 MET 51 46 46 MET MET A . n A 1 52 ARG 52 47 47 ARG ARG A . n A 1 53 MET 53 48 48 MET MET A . n A 1 54 ALA 54 49 49 ALA ALA A . n A 1 55 GLU 55 50 50 GLU GLU A . n A 1 56 GLY 56 51 51 GLY GLY A . n A 1 57 GLY 57 52 52 GLY GLY A . n A 1 58 VAL 58 53 53 VAL VAL A . n A 1 59 THR 59 54 54 THR THR A . n A 1 60 SER 60 55 55 SER SER A . n A 1 61 GLU 61 56 56 GLU GLU A . n A 1 62 ASP 62 57 57 ASP ASP A . n A 1 63 TYR 63 58 58 TYR TYR A . n A 1 64 ARG 64 59 59 ARG ARG A . n A 1 65 THR 65 60 60 THR THR A . n A 1 66 PHE 66 61 61 PHE PHE A . n A 1 67 LEU 67 62 62 LEU LEU A . n A 1 68 GLN 68 63 63 GLN GLN A . n A 1 69 GLN 69 64 64 GLN GLN A . n A 1 70 PRO 70 65 65 PRO PRO A . n A 1 71 SER 71 66 66 SER SER A . n A 1 72 GLY 72 67 67 GLY GLY A . n A 1 73 ASN 73 68 68 ASN ASN A . n A 1 74 MET 74 69 69 MET MET A . n A 1 75 ASP 75 70 70 ASP ASP A . n A 1 76 ASP 76 71 71 ASP ASP A . n A 1 77 SER 77 72 72 SER SER A . n A 1 78 GLY 78 73 73 GLY GLY A . n A 1 79 PHE 79 74 74 PHE PHE A . n A 1 80 PHE 80 75 75 PHE PHE A . n A 1 81 SER 81 76 76 SER SER A . n A 1 82 ILE 82 77 77 ILE ILE A . n A 1 83 GLN 83 78 78 GLN GLN A . n A 1 84 VAL 84 79 79 VAL VAL A . n A 1 85 ILE 85 80 80 ILE ILE A . n A 1 86 SER 86 81 81 SER SER A . n A 1 87 ASN 87 82 82 ASN ASN A . n A 1 88 ALA 88 83 83 ALA ALA A . n A 1 89 LEU 89 84 84 LEU LEU A . n A 1 90 LYS 90 85 85 LYS LYS A . n A 1 91 VAL 91 86 86 VAL VAL A . n A 1 92 TRP 92 87 87 TRP TRP A . n A 1 93 GLY 93 88 88 GLY GLY A . n A 1 94 LEU 94 89 89 LEU LEU A . n A 1 95 GLU 95 90 90 GLU GLU A . n A 1 96 LEU 96 91 91 LEU LEU A . n A 1 97 ILE 97 92 92 ILE ILE A . n A 1 98 LEU 98 93 93 LEU LEU A . n A 1 99 PHE 99 94 94 PHE PHE A . n A 1 100 ASN 100 95 95 ASN ASN A . n A 1 101 SER 101 96 96 SER SER A . n A 1 102 PRO 102 97 97 PRO PRO A . n A 1 103 GLU 103 98 98 GLU GLU A . n A 1 104 TYR 104 99 99 TYR TYR A . n A 1 105 GLN 105 100 100 GLN GLN A . n A 1 106 ARG 106 101 101 ARG ARG A . n A 1 107 LEU 107 102 102 LEU LEU A . n A 1 108 ARG 108 103 103 ARG ARG A . n A 1 109 ILE 109 104 104 ILE ILE A . n A 1 110 ASP 110 105 105 ASP ASP A . n A 1 111 PRO 111 106 106 PRO PRO A . n A 1 112 ILE 112 107 107 ILE ILE A . n A 1 113 ASN 113 108 108 ASN ASN A . n A 1 114 GLU 114 109 109 GLU GLU A . n A 1 115 ARG 115 110 110 ARG ARG A . n A 1 116 SER 116 111 111 SER SER A . n A 1 117 PHE 117 112 112 PHE PHE A . n A 1 118 ILE 118 113 113 ILE ILE A . n A 1 119 CYS 119 114 114 CYS CYS A . n A 1 120 ASN 120 115 115 ASN ASN A . n A 1 121 TYR 121 116 116 TYR TYR A . n A 1 122 LYS 122 117 117 LYS LYS A . n A 1 123 GLU 123 118 118 GLU GLU A . n A 1 124 HIS 124 119 119 HIS HIS A . n A 1 125 TRP 125 120 120 TRP TRP A . n A 1 126 PHE 126 121 121 PHE PHE A . n A 1 127 THR 127 122 122 THR THR A . n A 1 128 VAL 128 123 123 VAL VAL A . n A 1 129 ARG 129 124 124 ARG ARG A . n A 1 130 LYS 130 125 125 LYS LYS A . n A 1 131 LEU 131 126 126 LEU LEU A . n A 1 132 GLY 132 127 127 GLY GLY A . n A 1 133 LYS 133 128 128 LYS LYS A . n A 1 134 GLN 134 129 129 GLN GLN A . n A 1 135 TRP 135 130 130 TRP TRP A . n A 1 136 PHE 136 131 131 PHE PHE A . n A 1 137 ASN 137 132 132 ASN ASN A . n A 1 138 LEU 138 133 133 LEU LEU A . n A 1 139 ASN 139 134 134 ASN ASN A . n A 1 140 SER 140 135 135 SER SER A . n A 1 141 LEU 141 136 136 LEU LEU A . n A 1 142 LEU 142 137 137 LEU LEU A . n A 1 143 THR 143 138 138 THR THR A . n A 1 144 GLY 144 139 139 GLY GLY A . n A 1 145 PRO 145 140 140 PRO PRO A . n A 1 146 GLU 146 141 141 GLU GLU A . n A 1 147 LEU 147 142 142 LEU LEU A . n A 1 148 ILE 148 143 143 ILE ILE A . n A 1 149 SER 149 144 144 SER SER A . n A 1 150 ASP 150 145 145 ASP ASP A . n A 1 151 THR 151 146 146 THR THR A . n A 1 152 TYR 152 147 147 TYR TYR A . n A 1 153 LEU 153 148 148 LEU LEU A . n A 1 154 ALA 154 149 149 ALA ALA A . n A 1 155 LEU 155 150 150 LEU LEU A . n A 1 156 PHE 156 151 151 PHE PHE A . n A 1 157 LEU 157 152 152 LEU LEU A . n A 1 158 ALA 158 153 153 ALA ALA A . n A 1 159 GLN 159 154 154 GLN GLN A . n A 1 160 LEU 160 155 155 LEU LEU A . n A 1 161 GLN 161 156 156 GLN GLN A . n A 1 162 GLN 162 157 157 GLN GLN A . n A 1 163 GLU 163 158 158 GLU GLU A . n A 1 164 GLY 164 159 159 GLY GLY A . n A 1 165 TYR 165 160 160 TYR TYR A . n A 1 166 SER 166 161 161 SER SER A . n A 1 167 ILE 167 162 162 ILE ILE A . n A 1 168 PHE 168 163 163 PHE PHE A . n A 1 169 VAL 169 164 164 VAL VAL A . n A 1 170 VAL 170 165 165 VAL VAL A . n A 1 171 LYS 171 166 166 LYS LYS A . n A 1 172 GLY 172 167 167 GLY GLY A . n A 1 173 ASP 173 168 168 ASP ASP A . n A 1 174 LEU 174 169 169 LEU LEU A . n A 1 175 PRO 175 170 170 PRO PRO A . n A 1 176 ASP 176 171 171 ASP ASP A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-05-22 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2014-12-03 5 'Structure model' 1 4 2014-12-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Database references' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 7 ? ? -171.61 147.29 2 1 LEU A 13 ? ? 59.39 102.37 3 1 THR A 54 ? ? 179.43 159.20 4 1 GLN A 64 ? ? 63.57 73.81 5 1 PRO A 65 ? ? -69.77 -177.00 6 1 SER A 66 ? ? 51.98 -169.72 7 1 ASN A 68 ? ? -156.96 -48.69 8 1 ASP A 70 ? ? -111.41 -169.71 9 1 ASP A 71 ? ? 72.64 -68.52 10 1 PHE A 75 ? ? -79.97 -169.09 11 1 LYS A 117 ? ? -40.63 106.56 12 1 HIS A 119 ? ? 179.39 145.19 13 2 SER A 3 ? ? -150.83 25.65 14 2 LYS A 8 ? ? 60.28 101.07 15 2 SER A 55 ? ? -179.75 -75.67 16 2 GLN A 64 ? ? 179.81 155.33 17 2 PRO A 65 ? ? -69.72 -170.52 18 2 ASN A 68 ? ? -179.96 34.46 19 2 MET A 69 ? ? 69.13 -75.54 20 2 ASP A 70 ? ? 57.67 -177.99 21 2 ASP A 71 ? ? -140.91 24.82 22 2 SER A 72 ? ? -88.43 -75.19 23 2 PHE A 74 ? ? 51.03 88.02 24 2 SER A 76 ? ? 178.18 171.61 25 2 ARG A 110 ? ? -108.90 -63.43 26 2 LYS A 117 ? ? 58.77 -87.49 27 3 GLN A 64 ? ? 64.32 153.80 28 3 SER A 66 ? ? 72.27 -68.94 29 3 ASP A 70 ? ? -179.09 -42.45 30 3 PHE A 75 ? ? 52.97 -174.09 31 3 LYS A 117 ? ? -40.03 106.24 32 3 HIS A 119 ? ? -179.90 144.10 33 3 GLU A 158 ? ? -87.32 -71.88 34 4 SER A 3 ? ? -161.12 28.51 35 4 GLU A 7 ? ? -179.26 141.25 36 4 SER A 12 ? ? 66.06 145.05 37 4 GLN A 64 ? ? 179.25 156.95 38 4 PRO A 65 ? ? -69.74 -170.98 39 4 MET A 69 ? ? -70.30 -169.85 40 4 ASP A 70 ? ? -78.06 -75.53 41 4 PHE A 75 ? ? -61.03 -168.94 42 4 SER A 76 ? ? 178.35 177.07 43 4 LYS A 117 ? ? -43.17 106.69 44 4 GLU A 118 ? ? 70.39 44.72 45 4 HIS A 119 ? ? 179.63 148.89 46 5 GLU A 2 ? ? 73.70 -61.20 47 5 LYS A 8 ? ? 64.08 109.91 48 5 SER A 12 ? ? -108.76 -74.88 49 5 THR A 54 ? ? 64.38 163.11 50 5 GLN A 64 ? ? 60.53 69.94 51 5 PRO A 65 ? ? -69.71 -170.75 52 5 SER A 66 ? ? 63.24 162.74 53 5 MET A 69 ? ? 59.84 98.09 54 5 ASP A 70 ? ? -55.47 175.47 55 5 SER A 72 ? ? -179.56 34.15 56 5 GLU A 109 ? ? -60.76 -176.13 57 5 ARG A 110 ? ? -123.35 -56.16 58 5 LYS A 117 ? ? -19.55 -68.23 59 5 HIS A 119 ? ? 177.61 149.85 60 5 LYS A 128 ? ? -146.85 17.48 61 5 GLU A 158 ? ? -90.19 -65.78 62 6 SER A 3 ? ? -175.65 79.31 63 6 GLU A 7 ? ? -179.29 -33.99 64 6 LYS A 8 ? ? -49.63 165.30 65 6 SER A 12 ? ? -160.15 94.95 66 6 LEU A 13 ? ? 55.30 94.66 67 6 GLN A 24 ? ? 48.52 26.91 68 6 GLU A 26 ? ? 45.03 84.04 69 6 THR A 54 ? ? -113.64 -73.75 70 6 GLN A 64 ? ? 67.38 89.38 71 6 PRO A 65 ? ? -69.77 -170.84 72 6 SER A 66 ? ? -66.29 -176.69 73 6 SER A 72 ? ? -123.31 -70.17 74 6 PHE A 75 ? ? -127.51 -169.25 75 6 SER A 76 ? ? 179.46 171.24 76 6 ASN A 95 ? ? -108.03 40.17 77 6 LYS A 117 ? ? 59.22 -86.65 78 6 GLU A 158 ? ? -86.07 -72.23 79 7 GLU A 2 ? ? 73.56 -60.96 80 7 SER A 12 ? ? -163.21 -46.93 81 7 SER A 55 ? ? -179.56 -67.25 82 7 GLN A 64 ? ? -152.15 77.88 83 7 ASP A 71 ? ? 61.26 73.68 84 7 SER A 72 ? ? -172.82 -74.02 85 7 PHE A 74 ? ? 52.70 84.25 86 7 LYS A 117 ? ? 60.21 -86.71 87 7 LEU A 133 ? ? -180.00 149.51 88 8 SER A 3 ? ? -167.78 62.67 89 8 GLU A 7 ? ? -177.65 128.08 90 8 LEU A 13 ? ? 59.73 76.66 91 8 TYR A 27 ? ? -140.81 11.27 92 8 THR A 54 ? ? -133.91 -74.10 93 8 SER A 55 ? ? -143.45 -74.67 94 8 GLN A 64 ? ? 61.44 73.23 95 8 SER A 66 ? ? 51.08 -168.52 96 8 ASN A 68 ? ? -162.79 25.64 97 8 MET A 69 ? ? 64.96 -82.90 98 8 ASP A 70 ? ? 61.09 -86.02 99 8 ASP A 71 ? ? -179.61 33.82 100 8 SER A 72 ? ? -179.82 34.36 101 8 LYS A 117 ? ? 58.50 -86.67 102 9 GLU A 2 ? ? 38.90 35.18 103 9 SER A 3 ? ? 175.81 31.12 104 9 GLN A 64 ? ? 64.71 153.27 105 9 PRO A 65 ? ? -69.84 -167.19 106 9 SER A 66 ? ? -55.11 178.38 107 9 ASP A 71 ? ? -112.16 60.28 108 9 PHE A 74 ? ? 53.43 -172.37 109 9 PHE A 75 ? ? 66.65 141.30 110 10 SER A 3 ? ? -174.68 85.72 111 10 LEU A 13 ? ? 57.65 81.02 112 10 GLU A 26 ? ? -65.76 96.15 113 10 THR A 54 ? ? -90.28 -73.83 114 10 SER A 55 ? ? -159.06 -54.05 115 10 GLN A 64 ? ? -178.02 75.79 116 10 PRO A 65 ? ? -69.72 -170.70 117 10 SER A 66 ? ? -53.94 174.06 118 10 SER A 72 ? ? -139.10 -74.89 119 10 LYS A 117 ? ? -15.22 114.34 120 10 GLU A 118 ? ? 83.07 14.86 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -4 ? A GLY 1 2 1 Y 1 A PRO -3 ? A PRO 2 3 1 Y 1 A LEU -2 ? A LEU 3 4 1 Y 1 A GLY -1 ? A GLY 4 5 1 Y 1 A SER 0 ? A SER 5 6 2 Y 1 A GLY -4 ? A GLY 1 7 2 Y 1 A PRO -3 ? A PRO 2 8 2 Y 1 A LEU -2 ? A LEU 3 9 2 Y 1 A GLY -1 ? A GLY 4 10 2 Y 1 A SER 0 ? A SER 5 11 3 Y 1 A GLY -4 ? A GLY 1 12 3 Y 1 A PRO -3 ? A PRO 2 13 3 Y 1 A LEU -2 ? A LEU 3 14 3 Y 1 A GLY -1 ? A GLY 4 15 3 Y 1 A SER 0 ? A SER 5 16 4 Y 1 A GLY -4 ? A GLY 1 17 4 Y 1 A PRO -3 ? A PRO 2 18 4 Y 1 A LEU -2 ? A LEU 3 19 4 Y 1 A GLY -1 ? A GLY 4 20 4 Y 1 A SER 0 ? A SER 5 21 5 Y 1 A GLY -4 ? A GLY 1 22 5 Y 1 A PRO -3 ? A PRO 2 23 5 Y 1 A LEU -2 ? A LEU 3 24 5 Y 1 A GLY -1 ? A GLY 4 25 5 Y 1 A SER 0 ? A SER 5 26 6 Y 1 A GLY -4 ? A GLY 1 27 6 Y 1 A PRO -3 ? A PRO 2 28 6 Y 1 A LEU -2 ? A LEU 3 29 6 Y 1 A GLY -1 ? A GLY 4 30 6 Y 1 A SER 0 ? A SER 5 31 7 Y 1 A GLY -4 ? A GLY 1 32 7 Y 1 A PRO -3 ? A PRO 2 33 7 Y 1 A LEU -2 ? A LEU 3 34 7 Y 1 A GLY -1 ? A GLY 4 35 7 Y 1 A SER 0 ? A SER 5 36 8 Y 1 A GLY -4 ? A GLY 1 37 8 Y 1 A PRO -3 ? A PRO 2 38 8 Y 1 A LEU -2 ? A LEU 3 39 8 Y 1 A GLY -1 ? A GLY 4 40 8 Y 1 A SER 0 ? A SER 5 41 9 Y 1 A GLY -4 ? A GLY 1 42 9 Y 1 A PRO -3 ? A PRO 2 43 9 Y 1 A LEU -2 ? A LEU 3 44 9 Y 1 A GLY -1 ? A GLY 4 45 9 Y 1 A SER 0 ? A SER 5 46 10 Y 1 A GLY -4 ? A GLY 1 47 10 Y 1 A PRO -3 ? A PRO 2 48 10 Y 1 A LEU -2 ? A LEU 3 49 10 Y 1 A GLY -1 ? A GLY 4 50 10 Y 1 A SER 0 ? A SER 5 #