data_2E1O # _entry.id 2E1O # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2E1O pdb_00002e1o 10.2210/pdb2e1o/pdb RCSB RCSB026114 ? ? WWPDB D_1000026114 ? ? # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2006-11-14 _pdbx_database_PDB_obs_spr.pdb_id 2E1O _pdbx_database_PDB_obs_spr.replace_pdb_id 1WQI _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hss001000069.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2E1O _pdbx_database_status.recvd_initial_deposition_date 2006-10-27 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nakamura, A.' 1 'Ohnishi, S.' 2 'Abe, T.' 3 'Nameki, N.' 4 'Tochio, N.' 5 'Koshiba, S.' 6 'Kigawa, T.' 7 'Yokoyama, S.' 8 'Kawaii, S.' 9 'Hirota, H.' 10 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 11 # _citation.id primary _citation.title 'Solution structure of RSGI RUH-028, a homeobox domain from human cDNA' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nakamura, A.' 1 ? primary 'Ohnishi, S.' 2 ? primary 'Abe, T.' 3 ? primary 'Nameki, N.' 4 ? primary 'Tochio, N.' 5 ? primary 'Koshiba, S.' 6 ? primary 'Kigawa, T.' 7 ? primary 'Yokoyama, S.' 8 ? primary 'Kawaii, S.' 9 ? primary 'Hirota, H.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Homeobox protein PRH' _entity.formula_weight 8059.108 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'homeobox domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Hematopoietically expressed homeobox, Homeobox protein HEX' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hss001000069.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 LYS n 1 9 GLY n 1 10 GLY n 1 11 GLN n 1 12 VAL n 1 13 ARG n 1 14 PHE n 1 15 SER n 1 16 ASN n 1 17 ASP n 1 18 GLN n 1 19 THR n 1 20 ILE n 1 21 GLU n 1 22 LEU n 1 23 GLU n 1 24 LYS n 1 25 LYS n 1 26 PHE n 1 27 GLU n 1 28 THR n 1 29 GLN n 1 30 LYS n 1 31 TYR n 1 32 LEU n 1 33 SER n 1 34 PRO n 1 35 PRO n 1 36 GLU n 1 37 ARG n 1 38 LYS n 1 39 ARG n 1 40 LEU n 1 41 ALA n 1 42 LYS n 1 43 MET n 1 44 LEU n 1 45 GLN n 1 46 LEU n 1 47 SER n 1 48 GLU n 1 49 ARG n 1 50 GLN n 1 51 VAL n 1 52 LYS n 1 53 THR n 1 54 TRP n 1 55 PHE n 1 56 GLN n 1 57 ASN n 1 58 ARG n 1 59 ARG n 1 60 ALA n 1 61 LYS n 1 62 TRP n 1 63 ARG n 1 64 ARG n 1 65 SER n 1 66 GLY n 1 67 PRO n 1 68 SER n 1 69 SER n 1 70 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'HHEX, HEX, PRH, PRHX' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cell free synthesis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P040315-39 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HHEX_HUMAN _struct_ref.pdbx_db_accession Q03014 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRR _struct_ref.pdbx_align_begin 138 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2E1O _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 64 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q03014 _struct_ref_seq.db_align_beg 138 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 194 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 64 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2E1O GLY A 1 ? UNP Q03014 ? ? 'cloning artifact' 1 1 1 2E1O SER A 2 ? UNP Q03014 ? ? 'cloning artifact' 2 2 1 2E1O SER A 3 ? UNP Q03014 ? ? 'cloning artifact' 3 3 1 2E1O GLY A 4 ? UNP Q03014 ? ? 'cloning artifact' 4 4 1 2E1O SER A 5 ? UNP Q03014 ? ? 'cloning artifact' 5 5 1 2E1O SER A 6 ? UNP Q03014 ? ? 'cloning artifact' 6 6 1 2E1O GLY A 7 ? UNP Q03014 ? ? 'cloning artifact' 7 7 1 2E1O SER A 65 ? UNP Q03014 ? ? 'cloning artifact' 65 8 1 2E1O GLY A 66 ? UNP Q03014 ? ? 'cloning artifact' 66 9 1 2E1O PRO A 67 ? UNP Q03014 ? ? 'cloning artifact' 67 10 1 2E1O SER A 68 ? UNP Q03014 ? ? 'cloning artifact' 68 11 1 2E1O SER A 69 ? UNP Q03014 ? ? 'cloning artifact' 69 12 1 2E1O GLY A 70 ? UNP Q03014 ? ? 'cloning artifact' 70 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.92mM RSGI RUH-028 U-15N,13C, 20mM d-Tris-HCl(pH7.0), 100mM NaCl, 1mM d-DTT, 0.02% NaN3, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2E1O _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2E1O _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations,structures with the lowest energy,target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2E1O _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy and target function' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.6 Bruker 1 processing NMRPipe 2003.316.09.03 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B. A.' 3 'data analysis' KUJIRA 2.0.172 'Kobayashi, N.' 4 refinement CYANA 2.0.17 'Guntert, P.' 5 # _exptl.entry_id 2E1O _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2E1O _struct.title 'Solution structure of RSGI RUH-028, a homeobox domain from human cDNA' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2E1O _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;DNA binding protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 15 ? GLN A 29 ? SER A 15 GLN A 29 1 ? 15 HELX_P HELX_P2 2 SER A 33 ? LEU A 44 ? SER A 33 LEU A 44 1 ? 12 HELX_P HELX_P3 3 SER A 47 ? GLY A 66 ? SER A 47 GLY A 66 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2E1O _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2E1O _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 TRP 54 54 54 TRP TRP A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 TRP 62 62 62 TRP TRP A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLY 70 70 70 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-11-14 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 3 ? ? -35.17 145.76 2 1 LYS A 8 ? ? 39.32 38.03 3 1 GLN A 11 ? ? -95.75 41.98 4 1 ARG A 37 ? ? -33.88 -37.50 5 1 SER A 68 ? ? -34.44 98.79 6 2 LYS A 24 ? ? -39.03 -26.23 7 2 GLN A 29 ? ? -162.02 115.09 8 2 ARG A 37 ? ? -34.23 -34.38 9 2 GLU A 48 ? ? -39.57 -36.92 10 2 ALA A 60 ? ? -38.73 -38.07 11 3 LYS A 8 ? ? -36.89 105.45 12 3 LYS A 24 ? ? -39.84 -26.24 13 3 ARG A 37 ? ? -35.14 -39.78 14 4 SER A 3 ? ? -100.59 42.26 15 4 LYS A 8 ? ? -43.67 159.38 16 4 LEU A 22 ? ? -37.85 -31.77 17 4 ARG A 37 ? ? -34.48 -33.04 18 4 ALA A 60 ? ? -38.47 -39.35 19 5 LYS A 24 ? ? -36.88 -29.37 20 5 ARG A 37 ? ? -34.73 -33.00 21 6 SER A 3 ? ? -90.81 -60.08 22 6 ARG A 37 ? ? -35.77 -38.46 23 6 SER A 68 ? ? -162.82 116.89 24 7 ARG A 37 ? ? -34.32 -34.09 25 7 PRO A 67 ? ? -69.68 88.65 26 8 SER A 2 ? ? -68.72 82.89 27 8 SER A 6 ? ? -170.23 122.10 28 8 LEU A 22 ? ? -38.37 -28.20 29 8 ARG A 37 ? ? -34.13 -34.32 30 8 GLN A 45 ? ? 71.35 41.14 31 8 PRO A 67 ? ? -69.71 -177.48 32 8 SER A 69 ? ? -170.06 115.01 33 9 SER A 15 ? ? -55.42 173.43 34 9 ARG A 37 ? ? -34.09 -37.17 35 9 SER A 68 ? ? -125.49 -59.10 36 10 GLN A 11 ? ? -51.83 86.77 37 10 LEU A 22 ? ? -37.89 -35.55 38 10 ARG A 37 ? ? -34.92 -34.27 39 10 SER A 68 ? ? -126.77 -52.98 40 11 LEU A 22 ? ? -37.33 -38.85 41 11 ALA A 60 ? ? -38.79 -36.98 42 11 SER A 68 ? ? -39.15 139.77 43 12 SER A 5 ? ? -161.15 108.47 44 12 LEU A 22 ? ? -38.85 -33.84 45 12 ARG A 37 ? ? -35.19 -39.16 46 13 LEU A 22 ? ? -35.98 -34.14 47 13 ARG A 37 ? ? -34.90 -33.28 48 13 SER A 68 ? ? -51.87 174.24 49 14 ARG A 37 ? ? -34.32 -35.93 50 14 PRO A 67 ? ? -69.73 82.37 51 15 LEU A 22 ? ? -34.76 -39.23 52 15 ARG A 37 ? ? -34.25 -33.36 53 16 GLN A 11 ? ? -47.18 169.91 54 16 ARG A 37 ? ? -34.22 -39.15 55 16 ALA A 60 ? ? -39.61 -37.64 56 16 PRO A 67 ? ? -69.70 99.93 57 17 LEU A 22 ? ? -34.99 -33.76 58 17 ARG A 37 ? ? -34.15 -36.69 59 17 ALA A 60 ? ? -38.52 -39.73 60 18 ARG A 13 ? ? -97.00 34.16 61 18 SER A 15 ? ? -55.04 174.77 62 18 ARG A 37 ? ? -34.19 -35.40 63 18 PRO A 67 ? ? -69.80 2.65 64 18 SER A 68 ? ? -46.77 102.67 65 19 LYS A 24 ? ? -48.55 -19.26 66 19 SER A 68 ? ? -59.75 109.54 67 20 GLN A 29 ? ? -160.96 112.13 68 20 ARG A 37 ? ? -34.10 -34.27 #