data_2E29 # _entry.id 2E29 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2E29 pdb_00002e29 10.2210/pdb2e29/pdb RCSB RCSB026135 ? ? WWPDB D_1000026135 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002004504.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2E29 _pdbx_database_status.recvd_initial_deposition_date 2006-11-10 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ohnishi, S.' 1 'Paakkonen, K.' 2 'Guntert, P.' 3 'Sato, M.' 4 'Koshiba, S.' 5 'Harada, T.' 6 'Watanabe, S.' 7 'Kigawa, T.' 8 'Yokoyama, S.' 9 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 10 # _citation.id primary _citation.title 'Solution structure of the GUCT domain from human RNA helicase II/Gubeta reveals the RRM fold, but implausible RNA interactions' _citation.journal_abbrev Proteins _citation.journal_volume 74 _citation.page_first 133 _citation.page_last 144 _citation.year 2008 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18615715 _citation.pdbx_database_id_DOI 10.1002/prot.22138 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ohnishi, S.' 1 ? primary 'Paakkonen, K.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Tochio, N.' 4 ? primary 'Sato, M.' 5 ? primary 'Kobayashi, N.' 6 ? primary 'Harada, T.' 7 ? primary 'Watanabe, S.' 8 ? primary 'Muto, Y.' 9 ? primary 'Guntert, P.' 10 ? primary 'Tanaka, A.' 11 ? primary 'Kigawa, T.' 12 ? primary 'Yokoyama, S.' 13 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'ATP-dependent RNA helicase DDX50' _entity.formula_weight 10149.377 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.6.1.- _entity.pdbx_mutation ? _entity.pdbx_fragment 'GUCT domain, residues 8-92' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'DEAD box protein 50, Nucleolar protein Gu2, Gu-beta' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGFEPRSLITSDKGFVTMTLESLEEIQDVSCAWKELNRKLSSNAVSQITRMCLLKGNMGVCFDVPTTESERLQAE WHDSDWILSVPA ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGFEPRSLITSDKGFVTMTLESLEEIQDVSCAWKELNRKLSSNAVSQITRMCLLKGNMGVCFDVPTTESERLQAE WHDSDWILSVPA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002004504.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 PHE n 1 9 GLU n 1 10 PRO n 1 11 ARG n 1 12 SER n 1 13 LEU n 1 14 ILE n 1 15 THR n 1 16 SER n 1 17 ASP n 1 18 LYS n 1 19 GLY n 1 20 PHE n 1 21 VAL n 1 22 THR n 1 23 MET n 1 24 THR n 1 25 LEU n 1 26 GLU n 1 27 SER n 1 28 LEU n 1 29 GLU n 1 30 GLU n 1 31 ILE n 1 32 GLN n 1 33 ASP n 1 34 VAL n 1 35 SER n 1 36 CYS n 1 37 ALA n 1 38 TRP n 1 39 LYS n 1 40 GLU n 1 41 LEU n 1 42 ASN n 1 43 ARG n 1 44 LYS n 1 45 LEU n 1 46 SER n 1 47 SER n 1 48 ASN n 1 49 ALA n 1 50 VAL n 1 51 SER n 1 52 GLN n 1 53 ILE n 1 54 THR n 1 55 ARG n 1 56 MET n 1 57 CYS n 1 58 LEU n 1 59 LEU n 1 60 LYS n 1 61 GLY n 1 62 ASN n 1 63 MET n 1 64 GLY n 1 65 VAL n 1 66 CYS n 1 67 PHE n 1 68 ASP n 1 69 VAL n 1 70 PRO n 1 71 THR n 1 72 THR n 1 73 GLU n 1 74 SER n 1 75 GLU n 1 76 ARG n 1 77 LEU n 1 78 GLN n 1 79 ALA n 1 80 GLU n 1 81 TRP n 1 82 HIS n 1 83 ASP n 1 84 SER n 1 85 ASP n 1 86 TRP n 1 87 ILE n 1 88 LEU n 1 89 SER n 1 90 VAL n 1 91 PRO n 1 92 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene DDX50 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cell-free protein synthesis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060403-01 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DDX50_HUMAN _struct_ref.pdbx_db_accession Q9BQ39 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;FEPRSLITSDKGFVTMTLESLEEIQDVSCAWKELNRKLSSNAVSQITRMCLLKGNMGVCFDVPTTESERLQAEWHDSDWI LSVPA ; _struct_ref.pdbx_align_begin 575 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2E29 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 92 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9BQ39 _struct_ref_seq.db_align_beg 575 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 659 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 92 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2E29 GLY A 1 ? UNP Q9BQ39 ? ? 'expression tag' 1 1 1 2E29 SER A 2 ? UNP Q9BQ39 ? ? 'expression tag' 2 2 1 2E29 SER A 3 ? UNP Q9BQ39 ? ? 'expression tag' 3 3 1 2E29 GLY A 4 ? UNP Q9BQ39 ? ? 'expression tag' 4 4 1 2E29 SER A 5 ? UNP Q9BQ39 ? ? 'expression tag' 5 5 1 2E29 SER A 6 ? UNP Q9BQ39 ? ? 'expression tag' 6 6 1 2E29 GLY A 7 ? UNP Q9BQ39 ? ? 'expression tag' 7 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.9mM protein U-15N,13C; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 10% D2O, 90% H2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2E29 _pdbx_nmr_refine.method 'torsion angle dynamics, restrained molecular dynamics' _pdbx_nmr_refine.details 'HNN and CACO RDC data, obtained from the Pf1 phage system, were used in the torsion angle dynamics calculation.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2E29 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2E29 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9816 'Kobayashi, N.' 4 'structure solution' CYANA 2.1 'Guntert, P.' 5 refinement OPALp ? 'Koradi, R.' 6 # _exptl.entry_id 2E29 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2E29 _struct.title 'Solution structure of the GUCT domain from human ATP-dependent RNA helicase DDX50, DEAD box protein 50' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2E29 _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text ;ATP binding, Helicase, Hydrolase, Nuclear protein, Nucleotide-binding, RNA-binding, GUCT domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 VAL A 34 ? LEU A 45 ? VAL A 34 LEU A 45 1 ? 12 HELX_P HELX_P2 2 SER A 46 ? SER A 51 ? SER A 46 SER A 51 1 ? 6 HELX_P HELX_P3 3 THR A 71 ? TRP A 81 ? THR A 71 TRP A 81 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 54 ? LEU A 58 ? THR A 54 LEU A 58 A 2 GLY A 64 ? PRO A 70 ? GLY A 64 PRO A 70 A 3 PHE A 20 ? GLU A 26 ? PHE A 20 GLU A 26 A 4 ILE A 87 ? SER A 89 ? ILE A 87 SER A 89 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N THR A 54 ? N THR A 54 O ASP A 68 ? O ASP A 68 A 2 3 O PHE A 67 ? O PHE A 67 N MET A 23 ? N MET A 23 A 3 4 N THR A 24 ? N THR A 24 O SER A 89 ? O SER A 89 # _database_PDB_matrix.entry_id 2E29 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2E29 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 TRP 38 38 38 TRP TRP A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 CYS 57 57 57 CYS CYS A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 MET 63 63 63 MET MET A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 TRP 81 81 81 TRP TRP A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 TRP 86 86 86 TRP TRP A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 ALA 92 92 92 ALA ALA A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-05-15 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 40 ? ? HG A SER 84 ? ? 1.54 2 3 HG1 A THR 22 ? ? OD1 A ASP 68 ? ? 1.58 3 13 OE2 A GLU 40 ? ? HG A SER 84 ? ? 1.48 4 20 HG A SER 46 ? ? OE2 A GLU 80 ? ? 1.55 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 10 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 55 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 55 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 55 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 117.07 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation -3.23 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 8 ? ? 57.19 -174.31 2 1 SER A 16 ? ? -153.68 -76.13 3 1 ASN A 62 ? ? 56.47 17.20 4 2 GLU A 9 ? ? -155.08 82.87 5 2 LEU A 13 ? ? -152.27 -11.83 6 2 THR A 15 ? ? -144.33 20.06 7 2 LYS A 18 ? ? -142.91 -61.89 8 2 PRO A 91 ? ? -79.12 -157.63 9 3 GLU A 9 ? ? 44.87 75.96 10 4 SER A 2 ? ? -77.30 -90.82 11 4 SER A 3 ? ? 50.31 -160.78 12 4 ARG A 11 ? ? 47.45 -153.96 13 5 SER A 2 ? ? 61.63 173.61 14 5 ILE A 14 ? ? -118.35 -143.64 15 5 ASN A 62 ? ? 54.46 19.65 16 6 SER A 3 ? ? -159.00 88.15 17 6 SER A 5 ? ? -155.51 -75.18 18 6 SER A 6 ? ? 44.12 -120.39 19 6 SER A 16 ? ? -147.67 -70.90 20 6 ASN A 62 ? ? 57.05 17.23 21 7 SER A 16 ? ? -135.96 -59.49 22 7 ASN A 62 ? ? 52.88 15.87 23 7 MET A 63 ? ? -82.34 30.50 24 7 ASP A 83 ? ? 56.58 -4.36 25 8 SER A 2 ? ? 42.81 72.33 26 8 PHE A 8 ? ? -79.52 27.71 27 8 ARG A 11 ? ? 48.81 24.95 28 8 SER A 16 ? ? 76.22 177.02 29 8 ARG A 55 ? ? 35.22 63.10 30 8 ASN A 62 ? ? 54.89 6.25 31 8 ASP A 83 ? ? 55.29 3.25 32 8 PRO A 91 ? ? -66.97 -179.69 33 9 SER A 6 ? ? 58.30 -179.65 34 9 LEU A 13 ? ? -149.65 -40.44 35 9 ASN A 62 ? ? 57.87 10.16 36 9 MET A 63 ? ? -79.34 38.95 37 10 THR A 15 ? ? -161.80 -32.97 38 10 ASN A 62 ? ? 45.24 24.61 39 11 PHE A 8 ? ? 53.98 73.96 40 11 ASP A 17 ? ? -146.40 19.09 41 11 ASP A 83 ? ? 57.49 16.15 42 12 SER A 2 ? ? 73.21 152.93 43 12 ARG A 11 ? ? -152.97 88.26 44 12 SER A 12 ? ? -164.81 95.16 45 12 SER A 16 ? ? 158.98 -39.97 46 12 ASP A 33 ? ? -177.41 -177.78 47 12 ASN A 62 ? ? 57.54 9.17 48 13 SER A 5 ? ? -150.99 -7.59 49 13 PHE A 8 ? ? 70.77 81.48 50 13 LYS A 18 ? ? 35.43 54.67 51 13 ARG A 55 ? ? 41.35 70.11 52 14 PHE A 8 ? ? -74.77 30.45 53 14 SER A 12 ? ? -165.91 103.63 54 14 LEU A 13 ? ? -141.93 52.98 55 14 THR A 15 ? ? -160.23 -0.13 56 14 LYS A 18 ? ? -152.79 -13.46 57 14 GLU A 30 ? ? -48.77 152.25 58 14 GLN A 32 ? ? -64.63 -71.51 59 14 ASN A 62 ? ? 50.89 -4.47 60 14 PRO A 91 ? ? -82.68 -153.32 61 15 SER A 5 ? ? -63.11 98.99 62 15 ARG A 11 ? ? -156.10 84.56 63 15 LYS A 18 ? ? 46.12 24.86 64 15 GLU A 30 ? ? -54.85 103.28 65 15 ASN A 62 ? ? 58.74 4.43 66 15 MET A 63 ? ? -60.00 19.72 67 15 ASP A 85 ? ? -79.04 23.63 68 16 GLU A 9 ? ? -46.05 159.67 69 16 SER A 12 ? ? 84.92 -13.23 70 16 SER A 16 ? ? 67.87 -39.86 71 16 ASP A 17 ? ? -43.05 1.52 72 16 ASP A 83 ? ? 35.69 47.72 73 17 SER A 6 ? ? -153.94 -66.56 74 17 ARG A 11 ? ? 63.17 -171.81 75 17 ASN A 62 ? ? 51.30 5.29 76 17 ASP A 83 ? ? 59.82 18.58 77 18 SER A 3 ? ? 59.55 -153.52 78 18 PRO A 10 ? ? -77.78 31.38 79 18 SER A 12 ? ? -157.67 81.06 80 18 GLN A 32 ? ? -78.81 -71.29 81 18 PRO A 91 ? ? -79.92 -164.31 82 19 SER A 5 ? ? -140.85 -98.53 83 19 SER A 6 ? ? -50.48 -6.70 84 19 GLU A 9 ? ? 95.50 153.96 85 19 LEU A 13 ? ? -160.26 96.63 86 19 THR A 15 ? ? 45.53 -174.85 87 19 SER A 16 ? ? -142.46 -115.72 88 19 ASP A 33 ? ? -170.15 -168.78 89 19 ASN A 62 ? ? 53.84 14.57 90 19 TRP A 81 ? ? -68.35 90.88 91 20 SER A 5 ? ? -170.79 -171.34 92 20 SER A 6 ? ? -150.44 -31.76 93 20 PHE A 8 ? ? -69.16 9.85 94 20 ILE A 14 ? ? 46.75 74.94 95 20 MET A 63 ? ? -109.24 54.07 96 20 ASP A 83 ? ? -19.39 100.93 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 3 ARG A 11 ? ? 0.081 'SIDE CHAIN' 2 6 ARG A 43 ? ? 0.080 'SIDE CHAIN' 3 7 ARG A 55 ? ? 0.134 'SIDE CHAIN' 4 17 ARG A 43 ? ? 0.077 'SIDE CHAIN' 5 18 ARG A 55 ? ? 0.085 'SIDE CHAIN' #