data_2E2W # _entry.id 2E2W # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2E2W pdb_00002e2w 10.2210/pdb2e2w/pdb RCSB RCSB026156 ? ? WWPDB D_1000026156 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hso002000250.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2E2W _pdbx_database_status.recvd_initial_deposition_date 2006-11-17 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nagashima, T.' 1 'Hayashi, F.' 2 'Yokoyama, S.' 3 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 # _citation.id primary _citation.title 'Solution structure of the first BRCT domain of human DNA ligase IV' _citation.journal_abbrev 'TO BE PUBLISHED' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nagashima, T.' 1 ? primary 'Hayashi, F.' 2 ? primary 'Yokoyama, S.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'DNA ligase 4' _entity.formula_weight 12729.438 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 6.5.1.1 _entity.pdbx_mutation ? _entity.pdbx_fragment 'BRCT domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'DNA ligase IV, Polydeoxyribonucleotide synthase [ATP] 4' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGKISNIFEDVEFCVMSGTDSQPKPDLENRIAEFGGYIVQNPGPDTYCVIAGSENIRVKNIILSNKHDVVKPAWL LECFKTKSFVPWQPRFMIHMCPSTKEHFAREYD ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGKISNIFEDVEFCVMSGTDSQPKPDLENRIAEFGGYIVQNPGPDTYCVIAGSENIRVKNIILSNKHDVVKPAWL LECFKTKSFVPWQPRFMIHMCPSTKEHFAREYD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hso002000250.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 LYS n 1 9 ILE n 1 10 SER n 1 11 ASN n 1 12 ILE n 1 13 PHE n 1 14 GLU n 1 15 ASP n 1 16 VAL n 1 17 GLU n 1 18 PHE n 1 19 CYS n 1 20 VAL n 1 21 MET n 1 22 SER n 1 23 GLY n 1 24 THR n 1 25 ASP n 1 26 SER n 1 27 GLN n 1 28 PRO n 1 29 LYS n 1 30 PRO n 1 31 ASP n 1 32 LEU n 1 33 GLU n 1 34 ASN n 1 35 ARG n 1 36 ILE n 1 37 ALA n 1 38 GLU n 1 39 PHE n 1 40 GLY n 1 41 GLY n 1 42 TYR n 1 43 ILE n 1 44 VAL n 1 45 GLN n 1 46 ASN n 1 47 PRO n 1 48 GLY n 1 49 PRO n 1 50 ASP n 1 51 THR n 1 52 TYR n 1 53 CYS n 1 54 VAL n 1 55 ILE n 1 56 ALA n 1 57 GLY n 1 58 SER n 1 59 GLU n 1 60 ASN n 1 61 ILE n 1 62 ARG n 1 63 VAL n 1 64 LYS n 1 65 ASN n 1 66 ILE n 1 67 ILE n 1 68 LEU n 1 69 SER n 1 70 ASN n 1 71 LYS n 1 72 HIS n 1 73 ASP n 1 74 VAL n 1 75 VAL n 1 76 LYS n 1 77 PRO n 1 78 ALA n 1 79 TRP n 1 80 LEU n 1 81 LEU n 1 82 GLU n 1 83 CYS n 1 84 PHE n 1 85 LYS n 1 86 THR n 1 87 LYS n 1 88 SER n 1 89 PHE n 1 90 VAL n 1 91 PRO n 1 92 TRP n 1 93 GLN n 1 94 PRO n 1 95 ARG n 1 96 PHE n 1 97 MET n 1 98 ILE n 1 99 HIS n 1 100 MET n 1 101 CYS n 1 102 PRO n 1 103 SER n 1 104 THR n 1 105 LYS n 1 106 GLU n 1 107 HIS n 1 108 PHE n 1 109 ALA n 1 110 ARG n 1 111 GLU n 1 112 TYR n 1 113 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene LIG4 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060731-14 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DNL4_HUMAN _struct_ref.pdbx_db_accession P49917 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KISNIFEDVEFCVMSGTDSQPKPDLENRIAEFGGYIVQNPGPDTYCVIAGSENIRVKNIILSNKHDVVKPAWLLECFKTK SFVPWQPRFMIHMCPSTKEHFAREYD ; _struct_ref.pdbx_align_begin 654 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2E2W _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 113 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P49917 _struct_ref_seq.db_align_beg 654 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 759 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 113 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2E2W GLY A 1 ? UNP P49917 ? ? 'cloning artifact' 1 1 1 2E2W SER A 2 ? UNP P49917 ? ? 'cloning artifact' 2 2 1 2E2W SER A 3 ? UNP P49917 ? ? 'cloning artifact' 3 3 1 2E2W GLY A 4 ? UNP P49917 ? ? 'cloning artifact' 4 4 1 2E2W SER A 5 ? UNP P49917 ? ? 'cloning artifact' 5 5 1 2E2W SER A 6 ? UNP P49917 ? ? 'cloning artifact' 6 6 1 2E2W GLY A 7 ? UNP P49917 ? ? 'cloning artifact' 7 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.23mM uniformly 13C and 15N labelled protein; 20mM TrisHCl, 100mM NaCl, 1mM DTT, 0.02% NaN3, 10% D2O, 90% H2O' _pdbx_nmr_sample_details.solvent_system '10% D2O, 90% H2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2E2W _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2E2W _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy,target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2E2W _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20020425 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9816 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2E2W _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2E2W _struct.title 'Solution structure of the first BRCT domain of human DNA ligase IV' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2E2W _struct_keywords.pdbx_keywords LIGASE _struct_keywords.text ;3layers a/b/a, parallel beta-sheet of 4 strands, XRCC4, non-homologous end jointing, V(D)J recombination, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIGASE ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 28 ? PHE A 39 ? PRO A 28 PHE A 39 1 ? 12 HELX_P HELX_P2 2 ASN A 60 ? ASN A 70 ? ASN A 60 ASN A 70 1 ? 11 HELX_P HELX_P3 3 LYS A 76 ? LYS A 87 ? LYS A 76 LYS A 87 1 ? 12 HELX_P HELX_P4 4 THR A 104 ? ASP A 113 ? THR A 104 ASP A 113 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 41 ? VAL A 44 ? GLY A 41 VAL A 44 A 2 VAL A 16 ? SER A 22 ? VAL A 16 SER A 22 A 3 VAL A 54 ? ALA A 56 ? VAL A 54 ALA A 56 A 4 VAL A 74 ? VAL A 75 ? VAL A 74 VAL A 75 A 5 MET A 97 ? HIS A 99 ? MET A 97 HIS A 99 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O TYR A 42 ? O TYR A 42 N VAL A 16 ? N VAL A 16 A 2 3 N CYS A 19 ? N CYS A 19 O ILE A 55 ? O ILE A 55 A 3 4 N ALA A 56 ? N ALA A 56 O VAL A 75 ? O VAL A 75 A 4 5 N VAL A 74 ? N VAL A 74 O ILE A 98 ? O ILE A 98 # _database_PDB_matrix.entry_id 2E2W _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2E2W _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 HIS 72 72 72 HIS HIS A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 TRP 79 79 79 TRP TRP A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 CYS 83 83 83 CYS CYS A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 TRP 92 92 92 TRP TRP A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 MET 97 97 97 MET MET A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 HIS 99 99 99 HIS HIS A . n A 1 100 MET 100 100 100 MET MET A . n A 1 101 CYS 101 101 101 CYS CYS A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 HIS 107 107 107 HIS HIS A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 TYR 112 112 112 TYR TYR A . n A 1 113 ASP 113 113 113 ASP ASP A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-12-05 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 30 ? ? -69.74 17.27 2 1 ASP A 50 ? ? -109.70 44.29 3 1 CYS A 101 ? ? -42.87 161.00 4 2 PRO A 28 ? ? -69.75 -179.26 5 2 PRO A 30 ? ? -69.82 8.02 6 2 ASP A 50 ? ? -109.25 44.24 7 2 TRP A 79 ? ? -39.16 -35.99 8 3 SER A 3 ? ? -54.06 107.98 9 3 SER A 5 ? ? -38.20 149.15 10 3 PRO A 28 ? ? -69.79 -178.46 11 3 PRO A 30 ? ? -69.77 6.64 12 3 ASP A 50 ? ? -104.55 42.31 13 3 TRP A 79 ? ? -39.24 -39.05 14 3 CYS A 101 ? ? -49.07 159.12 15 4 SER A 5 ? ? -171.39 135.24 16 4 PRO A 28 ? ? -69.76 -178.78 17 4 PRO A 30 ? ? -69.79 8.46 18 4 ASP A 50 ? ? -104.26 42.12 19 4 PRO A 77 ? ? -69.71 2.85 20 4 PRO A 91 ? ? -69.78 -164.33 21 4 CYS A 101 ? ? -44.00 162.91 22 5 SER A 5 ? ? -44.36 94.99 23 5 PRO A 30 ? ? -69.80 15.03 24 5 ASP A 50 ? ? -107.16 43.68 25 5 LYS A 71 ? ? -120.75 -53.31 26 5 PRO A 77 ? ? -69.74 0.55 27 5 PRO A 91 ? ? -69.78 -175.80 28 5 CYS A 101 ? ? -48.56 161.40 29 6 PRO A 30 ? ? -69.72 14.73 30 6 ASP A 50 ? ? -109.94 44.98 31 6 ASN A 70 ? ? 35.98 44.71 32 6 HIS A 99 ? ? -163.34 105.03 33 7 PRO A 30 ? ? -69.76 15.57 34 7 PHE A 89 ? ? -48.97 101.57 35 7 CYS A 101 ? ? -44.59 159.26 36 8 ASP A 15 ? ? 71.82 33.59 37 8 PRO A 30 ? ? -69.70 17.03 38 8 ASP A 50 ? ? -107.73 43.22 39 8 TYR A 52 ? ? -91.50 -64.15 40 8 LYS A 87 ? ? 37.82 43.78 41 8 PRO A 91 ? ? -69.82 -178.28 42 8 CYS A 101 ? ? -44.53 160.61 43 9 SER A 2 ? ? -172.78 147.80 44 9 ASN A 11 ? ? -102.11 48.11 45 9 ASP A 15 ? ? 72.70 31.89 46 9 PRO A 30 ? ? -69.72 18.16 47 9 ASP A 50 ? ? -103.94 42.60 48 9 GLU A 59 ? ? -60.39 91.72 49 9 MET A 100 ? ? -52.87 -174.88 50 10 ASN A 11 ? ? -85.09 37.87 51 10 PRO A 30 ? ? -69.79 17.79 52 10 ASP A 50 ? ? -98.80 38.70 53 10 PHE A 89 ? ? -66.43 97.84 54 10 LYS A 105 ? ? -33.85 -33.99 55 11 PRO A 30 ? ? -69.75 17.32 56 11 ASP A 50 ? ? -101.90 40.37 57 11 LYS A 87 ? ? 39.85 41.49 58 11 CYS A 101 ? ? -40.09 160.87 59 12 PRO A 30 ? ? -69.73 17.95 60 12 CYS A 101 ? ? -40.58 161.16 61 13 PRO A 28 ? ? -69.75 -167.38 62 13 PRO A 30 ? ? -69.78 14.06 63 13 ASP A 50 ? ? -106.48 42.85 64 13 PRO A 77 ? ? -69.72 1.17 65 13 LYS A 87 ? ? 34.68 43.10 66 14 SER A 2 ? ? 37.93 41.70 67 14 PRO A 28 ? ? -69.72 -169.95 68 14 PRO A 30 ? ? -69.78 17.86 69 14 ASP A 50 ? ? -103.00 40.77 70 14 PRO A 77 ? ? -69.76 0.59 71 14 PHE A 89 ? ? -67.86 98.55 72 14 CYS A 101 ? ? -40.58 158.85 73 15 PRO A 30 ? ? -69.75 14.01 74 15 ASN A 34 ? ? -63.96 -70.80 75 15 ASP A 50 ? ? -99.65 39.89 76 15 SER A 69 ? ? -39.31 -29.55 77 15 HIS A 99 ? ? -160.98 112.00 78 16 ASN A 11 ? ? -103.78 42.12 79 16 PRO A 30 ? ? -69.78 17.00 80 16 ASN A 65 ? ? -39.31 -38.57 81 16 PHE A 89 ? ? -60.35 96.17 82 16 LYS A 105 ? ? -36.23 -36.77 83 17 PRO A 30 ? ? -69.76 18.96 84 17 ASP A 50 ? ? -106.10 42.26 85 17 CYS A 101 ? ? -48.65 160.14 86 18 PRO A 30 ? ? -69.78 13.52 87 18 THR A 51 ? ? -33.92 129.31 88 18 ASP A 73 ? ? -40.36 156.65 89 18 CYS A 101 ? ? -43.16 161.12 90 19 PRO A 30 ? ? -69.75 17.82 91 19 ASP A 50 ? ? -109.14 46.85 92 19 PRO A 77 ? ? -69.78 2.94 93 20 SER A 5 ? ? -68.45 83.40 94 20 SER A 6 ? ? -89.24 43.94 95 20 SER A 10 ? ? -164.91 119.78 96 20 ASP A 15 ? ? 70.95 34.52 97 20 PRO A 30 ? ? -69.73 12.43 98 20 ASP A 50 ? ? -105.96 44.39 99 20 SER A 69 ? ? -38.54 -36.19 #