data_2E3E # _entry.id 2E3E # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.350 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2E3E pdb_00002e3e 10.2210/pdb2e3e/pdb RCSB RCSB026174 ? ? WWPDB D_1000026174 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2NY8 . unspecified PDB 2NY9 . unspecified PDB 2NZ3 . unspecified PDB 2E3F . unspecified PDB 2E3G . unspecified # _pdbx_database_status.entry_id 2E3E _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.recvd_initial_deposition_date 2006-11-22 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry N _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Landon, C.' 1 'Barbault, F.' 2 'Vovelle, F.' 3 # _citation.id primary _citation.title 'Rational design of peptides active against the gram positive bacteria Staphylococcus aureus' _citation.journal_abbrev Proteins _citation.journal_volume 72 _citation.page_first 229 _citation.page_last 239 _citation.year 2008 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18214975 _citation.pdbx_database_id_DOI 10.1002/prot.21912 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Landon, C.' 1 ? primary 'Barbault, F.' 2 ? primary 'Legrain, M.' 3 ? primary 'Guenneugues, M.' 4 ? primary 'Vovelle, F.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'defensin, mutant DEF-BBB' _entity.formula_weight 5006.769 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'residues 63-102' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ATCDLASFSSQWVTPNDSLCAAHCLVKGYRGGYCKNKICHCRDKF _entity_poly.pdbx_seq_one_letter_code_can ATCDLASFSSQWVTPNDSLCAAHCLVKGYRGGYCKNKICHCRDKF _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 THR n 1 3 CYS n 1 4 ASP n 1 5 LEU n 1 6 ALA n 1 7 SER n 1 8 PHE n 1 9 SER n 1 10 SER n 1 11 GLN n 1 12 TRP n 1 13 VAL n 1 14 THR n 1 15 PRO n 1 16 ASN n 1 17 ASP n 1 18 SER n 1 19 LEU n 1 20 CYS n 1 21 ALA n 1 22 ALA n 1 23 HIS n 1 24 CYS n 1 25 LEU n 1 26 VAL n 1 27 LYS n 1 28 GLY n 1 29 TYR n 1 30 ARG n 1 31 GLY n 1 32 GLY n 1 33 TYR n 1 34 CYS n 1 35 LYS n 1 36 ASN n 1 37 LYS n 1 38 ILE n 1 39 CYS n 1 40 HIS n 1 41 CYS n 1 42 ARG n 1 43 ASP n 1 44 LYS n 1 45 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'African malaria mosquito' _entity_src_gen.gene_src_genus Anopheles _entity_src_gen.pdbx_gene_src_gene DEF1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Anopheles gambiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7165 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ;baker's yeast ; _entity_src_gen.pdbx_host_org_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4932 _entity_src_gen.host_org_genus Saccharomyces _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DEFI_ANOGA _struct_ref.pdbx_db_accession Q17027 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ATCDLASGFGVGSSLCAAHCIARRYRGGYCNSKAVCVCRN _struct_ref.pdbx_align_begin 63 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2E3E _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 43 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q17027 _struct_ref_seq.db_align_beg 63 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 102 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 43 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2E3E ? A ? ? UNP Q17027 GLY 70 deletion ? 1 1 2E3E SER A 9 ? UNP Q17027 ? ? 'engineered mutation' 9 2 1 2E3E SER A 10 ? UNP Q17027 ? ? 'engineered mutation' 10 3 1 2E3E GLN A 11 ? UNP Q17027 ? ? 'engineered mutation' 11 4 1 2E3E TRP A 12 ? UNP Q17027 GLY 72 'engineered mutation' 12 5 1 2E3E THR A 14 ? UNP Q17027 ? ? 'engineered mutation' 14 6 1 2E3E PRO A 15 ? UNP Q17027 ? ? 'engineered mutation' 15 7 1 2E3E ASN A 16 ? UNP Q17027 GLY 74 'engineered mutation' 16 8 1 2E3E ASP A 17 ? UNP Q17027 SER 75 'engineered mutation' 17 9 1 2E3E LEU A 25 ? UNP Q17027 ILE 83 'engineered mutation' 25 10 1 2E3E VAL A 26 ? UNP Q17027 ALA 84 'engineered mutation' 26 11 1 2E3E LYS A 27 ? UNP Q17027 ARG 85 'engineered mutation' 27 12 1 2E3E GLY A 28 ? UNP Q17027 ARG 86 'engineered mutation' 28 13 1 2E3E LYS A 35 ? UNP Q17027 ASN 93 'engineered mutation' 35 14 1 2E3E ASN A 36 ? UNP Q17027 SER 94 'engineered mutation' 36 15 1 2E3E ? A ? ? UNP Q17027 ALA 96 deletion ? 16 1 2E3E ILE A 38 ? UNP Q17027 VAL 97 'engineered mutation' 38 17 1 2E3E HIS A 40 ? UNP Q17027 VAL 99 'engineered mutation' 40 18 1 2E3E ASP A 43 ? UNP Q17027 ASN 102 'engineered mutation' 43 19 1 2E3E LYS A 44 ? UNP Q17027 ? ? 'engineered mutation' 44 20 1 2E3E PHE A 45 ? UNP Q17027 ? ? 'engineered mutation' 45 21 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 DQF-COSY 1 2 1 '2D TOCSY' 1 3 1 '2D NOESY' 1 4 2 DQF-COSY 1 5 2 '2D TOCSY' 1 6 2 '2D NOESY' 1 # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 293 ambient 4.9 '40mM sodium acetate buffer' . K 2 303 ambient 4.9 '40mM sodium acetate buffer' . K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '2mM DEF-BBB, 40mM sodium acetate buffer' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2E3E _pdbx_nmr_refine.method 'Simulated annealing with torsion angle space (ARIA/CNS)' _pdbx_nmr_refine.details 'The structures are based on a total of 507 NOE-derived distance constraints' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2E3E _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear techniques' # _pdbx_nmr_ensemble.entry_id 2E3E _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 9 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy and the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2E3E _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest restraint energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal processing NMRPipe 2.2 Delaglio 1 'data analysis' NMRView 5.0 Johnson 2 'structure solution' ARIA 1.1 'Linge & Nilges' 3 'structure solution' CNS 1.1 Brunger 4 refinement CNS 1.1 Brunger 5 # _exptl.entry_id 2E3E _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2E3E _struct.title 'NMR structure of DEF-BBB, a mutant of anopheles defensin DEF-AAA' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2E3E _struct_keywords.pdbx_keywords 'ANTIMICROBIAL PROTEIN' _struct_keywords.text 'insect defensin; CSab motif; antibacterial, ANTIMICROBIAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ALA _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 21 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 28 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ALA _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 21 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 28 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 3 A CYS 34 1_555 ? ? ? ? ? ? ? 2.028 ? ? disulf2 disulf ? ? A CYS 20 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 20 A CYS 39 1_555 ? ? ? ? ? ? ? 2.026 ? ? disulf3 disulf ? ? A CYS 24 SG ? ? ? 1_555 A CYS 41 SG ? ? A CYS 24 A CYS 41 1_555 ? ? ? ? ? ? ? 2.024 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 32 ? LYS A 35 ? GLY A 32 LYS A 35 A 2 ILE A 38 ? CYS A 41 ? ILE A 38 CYS A 41 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 33 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 33 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id HIS _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 40 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id HIS _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 40 # _atom_sites.entry_id 2E3E _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 TRP 12 12 12 TRP TRP A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 PHE 45 45 45 PHE PHE A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-11-13 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2021-10-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_struct_assembly 3 3 'Structure model' pdbx_struct_oper_list 4 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HA A CYS 34 ? ? HA A CYS 39 ? ? 1.32 2 2 HH A TYR 33 ? ? OD1 A ASP 43 ? ? 1.60 3 5 O A SER 18 ? ? H A CYS 20 ? ? 1.59 4 8 O A PHE 8 ? ? HG A SER 9 ? ? 1.60 5 9 HA A CYS 20 ? ? HB2 A CYS 39 ? ? 1.27 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 3 ? ? -82.01 38.16 2 1 ASP A 4 ? ? -97.14 33.55 3 1 LEU A 5 ? ? -140.68 -155.70 4 1 PHE A 8 ? ? 63.37 -129.79 5 1 SER A 9 ? ? -92.85 31.82 6 1 VAL A 13 ? ? -79.09 39.29 7 1 ASN A 16 ? ? -167.52 -35.06 8 1 SER A 18 ? ? -59.25 -72.78 9 1 LEU A 19 ? ? 71.11 -42.95 10 1 CYS A 20 ? ? -174.13 45.16 11 1 ALA A 21 ? ? -156.23 -92.25 12 1 ARG A 30 ? ? -145.21 39.03 13 1 ASN A 36 ? ? 71.86 -63.14 14 1 LYS A 37 ? ? -156.05 -41.60 15 2 THR A 2 ? ? -128.35 -129.66 16 2 ASP A 4 ? ? 64.97 151.04 17 2 SER A 9 ? ? -173.92 48.31 18 2 ASN A 16 ? ? -109.93 -147.96 19 2 ASP A 17 ? ? 69.25 -67.36 20 2 ALA A 22 ? ? -76.72 49.12 21 2 HIS A 23 ? ? -163.52 -50.03 22 2 LYS A 37 ? ? 68.97 -22.97 23 2 CYS A 41 ? ? -90.63 -104.51 24 2 ARG A 42 ? ? 62.90 -177.48 25 3 SER A 9 ? ? 70.27 159.84 26 3 GLN A 11 ? ? -77.30 -127.79 27 3 VAL A 13 ? ? 67.12 126.83 28 3 THR A 14 ? ? 49.64 78.94 29 3 SER A 18 ? ? -165.68 -26.03 30 3 LEU A 19 ? ? 78.41 -37.61 31 3 CYS A 20 ? ? -163.59 -37.23 32 3 HIS A 23 ? ? -159.24 -47.66 33 3 ASN A 36 ? ? 74.92 -50.83 34 3 LYS A 37 ? ? -171.83 -47.74 35 3 CYS A 41 ? ? -65.22 -110.87 36 3 ARG A 42 ? ? 74.69 144.22 37 3 ASP A 43 ? ? 67.18 86.66 38 4 CYS A 3 ? ? -146.82 37.68 39 4 GLN A 11 ? ? -74.15 42.19 40 4 VAL A 13 ? ? -176.08 127.80 41 4 THR A 14 ? ? 74.69 131.83 42 4 PRO A 15 ? ? -85.13 42.48 43 4 ASN A 16 ? ? -172.54 54.28 44 4 ASP A 17 ? ? -99.35 -136.52 45 4 ASN A 36 ? ? 74.80 -42.96 46 4 LYS A 37 ? ? -164.90 -45.33 47 4 ARG A 42 ? ? -153.45 29.72 48 4 ASP A 43 ? ? -114.71 -144.54 49 5 CYS A 3 ? ? 64.53 -159.63 50 5 GLN A 11 ? ? -171.91 41.27 51 5 VAL A 13 ? ? 75.06 128.39 52 5 ASP A 17 ? ? -174.97 138.93 53 5 LEU A 19 ? ? 59.99 -40.05 54 5 CYS A 20 ? ? -177.66 48.50 55 5 ALA A 21 ? ? -134.39 -70.69 56 5 ARG A 30 ? ? -81.94 49.30 57 5 ASN A 36 ? ? 75.73 -33.63 58 5 LYS A 37 ? ? -146.82 -57.53 59 5 ARG A 42 ? ? -167.02 44.94 60 5 ASP A 43 ? ? -151.14 70.60 61 6 CYS A 3 ? ? -81.74 -102.86 62 6 ALA A 6 ? ? -81.68 49.88 63 6 SER A 7 ? ? -172.29 62.36 64 6 SER A 9 ? ? 64.16 -169.57 65 6 ASN A 16 ? ? -151.75 -141.64 66 6 SER A 18 ? ? -77.28 47.88 67 6 CYS A 20 ? ? -157.95 37.61 68 6 ALA A 21 ? ? -154.07 40.92 69 6 ASN A 36 ? ? 63.17 -113.88 70 6 ARG A 42 ? ? -156.28 61.50 71 6 ASP A 43 ? ? -157.15 71.50 72 7 ASP A 4 ? ? -169.00 -148.40 73 7 ALA A 6 ? ? -171.28 109.42 74 7 SER A 7 ? ? -170.47 129.33 75 7 SER A 9 ? ? 47.46 -118.51 76 7 SER A 10 ? ? 64.42 168.47 77 7 VAL A 13 ? ? 60.07 78.38 78 7 THR A 14 ? ? 56.97 81.39 79 7 PRO A 15 ? ? -66.24 75.91 80 7 ASN A 16 ? ? -79.27 47.54 81 7 ASP A 17 ? ? 72.48 -39.95 82 7 SER A 18 ? ? -163.10 107.94 83 7 CYS A 20 ? ? -158.50 58.10 84 7 ALA A 21 ? ? -159.04 -67.83 85 7 ARG A 42 ? ? -172.35 46.11 86 7 ASP A 43 ? ? -166.23 114.72 87 8 CYS A 3 ? ? -141.47 -143.08 88 8 SER A 7 ? ? -163.71 -143.95 89 8 SER A 9 ? ? 56.44 -177.46 90 8 SER A 10 ? ? 64.73 171.57 91 8 TRP A 12 ? ? -165.35 73.41 92 8 VAL A 13 ? ? 82.66 125.04 93 8 THR A 14 ? ? 55.53 84.12 94 8 PRO A 15 ? ? -68.42 60.81 95 8 ASN A 16 ? ? -83.61 -147.85 96 8 SER A 18 ? ? -168.02 100.92 97 8 CYS A 20 ? ? -151.32 60.15 98 8 ALA A 21 ? ? -164.88 -85.57 99 8 ARG A 30 ? ? -95.80 59.29 100 8 ARG A 42 ? ? -172.54 47.08 101 9 THR A 2 ? ? -141.12 42.86 102 9 ALA A 6 ? ? 53.32 -136.44 103 9 SER A 7 ? ? -151.36 -132.59 104 9 GLN A 11 ? ? -82.51 -131.92 105 9 VAL A 13 ? ? -170.89 144.39 106 9 THR A 14 ? ? 73.51 118.55 107 9 LEU A 19 ? ? 73.52 -39.24 108 9 CYS A 20 ? ? -155.55 -45.53 109 9 ALA A 21 ? ? -176.15 40.92 110 9 ALA A 22 ? ? -58.96 -76.40 111 9 ASN A 36 ? ? 62.14 -129.16 112 9 CYS A 41 ? ? -77.45 -138.07 113 9 ARG A 42 ? ? 86.20 41.36 #