data_2E5P # _entry.id 2E5P # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2E5P pdb_00002e5p 10.2210/pdb2e5p/pdb RCSB RCSB026257 ? ? WWPDB D_1000026257 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002006522.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2E5P _pdbx_database_status.recvd_initial_deposition_date 2006-12-22 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Dang, W.' 1 'Muto, Y.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Shirouzu, M.' 5 'Terada, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of the TUDOR domain of PHD finger protein 1 (PHF1 protein)' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dang, W.' 1 ? primary 'Muto, Y.' 2 ? primary 'Inoue, M.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Shirouzu, M.' 5 ? primary 'Terada, T.' 6 ? primary 'Yokoyama, S.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'PHD finger protein 1' _entity.formula_weight 7304.127 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'TUDOR domain, residues 8-62' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Protein PHF1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002006522.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 PRO n 1 9 ARG n 1 10 LEU n 1 11 TRP n 1 12 GLU n 1 13 GLY n 1 14 GLN n 1 15 ASP n 1 16 VAL n 1 17 LEU n 1 18 ALA n 1 19 ARG n 1 20 TRP n 1 21 THR n 1 22 ASP n 1 23 GLY n 1 24 LEU n 1 25 LEU n 1 26 TYR n 1 27 LEU n 1 28 GLY n 1 29 THR n 1 30 ILE n 1 31 LYS n 1 32 LYS n 1 33 VAL n 1 34 ASP n 1 35 SER n 1 36 ALA n 1 37 ARG n 1 38 GLU n 1 39 VAL n 1 40 CYS n 1 41 LEU n 1 42 VAL n 1 43 GLN n 1 44 PHE n 1 45 GLU n 1 46 ASP n 1 47 ASP n 1 48 SER n 1 49 GLN n 1 50 PHE n 1 51 LEU n 1 52 VAL n 1 53 LEU n 1 54 TRP n 1 55 LYS n 1 56 ASP n 1 57 ILE n 1 58 SER n 1 59 PRO n 1 60 ALA n 1 61 ALA n 1 62 LEU n 1 63 SER n 1 64 GLY n 1 65 PRO n 1 66 SER n 1 67 SER n 1 68 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene PHF1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050822-22 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PHF1_HUMAN _struct_ref.pdbx_db_accession O43189 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code PRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAAL _struct_ref.pdbx_align_begin 29 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2E5P _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 62 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O43189 _struct_ref_seq.db_align_beg 29 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 83 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 62 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2E5P GLY A 1 ? UNP O43189 ? ? 'cloning artifact' 1 1 1 2E5P SER A 2 ? UNP O43189 ? ? 'cloning artifact' 2 2 1 2E5P SER A 3 ? UNP O43189 ? ? 'cloning artifact' 3 3 1 2E5P GLY A 4 ? UNP O43189 ? ? 'cloning artifact' 4 4 1 2E5P SER A 5 ? UNP O43189 ? ? 'cloning artifact' 5 5 1 2E5P SER A 6 ? UNP O43189 ? ? 'cloning artifact' 6 6 1 2E5P GLY A 7 ? UNP O43189 ? ? 'cloning artifact' 7 7 1 2E5P SER A 63 ? UNP O43189 ? ? 'cloning artifact' 63 8 1 2E5P GLY A 64 ? UNP O43189 ? ? 'cloning artifact' 64 9 1 2E5P PRO A 65 ? UNP O43189 ? ? 'cloning artifact' 65 10 1 2E5P SER A 66 ? UNP O43189 ? ? 'cloning artifact' 66 11 1 2E5P SER A 67 ? UNP O43189 ? ? 'cloning artifact' 67 12 1 2E5P GLY A 68 ? UNP O43189 ? ? 'cloning artifact' 68 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 10% D2O, 90% H2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2E5P _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2E5P _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2E5P _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.6 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9814 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2E5P _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2E5P _struct.title 'Solution structure of the TUDOR domain of PHD finger protein 1 (PHF1 protein)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2E5P _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text ;TUDOR domain, PHD finger protein 1, PHF1 protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 48 ? LEU A 53 ? SER A 48 LEU A 53 A 2 VAL A 39 ? PHE A 44 ? VAL A 39 PHE A 44 A 3 LEU A 25 ? ASP A 34 ? LEU A 25 ASP A 34 A 4 ASP A 15 ? ARG A 19 ? ASP A 15 ARG A 19 A 5 ILE A 57 ? SER A 58 ? ILE A 57 SER A 58 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 52 ? O VAL A 52 N CYS A 40 ? N CYS A 40 A 2 3 O LEU A 41 ? O LEU A 41 N LYS A 31 ? N LYS A 31 A 3 4 O GLY A 28 ? O GLY A 28 N VAL A 16 ? N VAL A 16 A 4 5 N LEU A 17 ? N LEU A 17 O SER A 58 ? O SER A 58 # _database_PDB_matrix.entry_id 2E5P _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2E5P _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 TRP 11 11 11 TRP TRP A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 TRP 20 20 20 TRP TRP A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 TRP 54 54 54 TRP TRP A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 GLY 68 68 68 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-06-26 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 30 ? ? -59.11 100.49 2 1 ASP A 46 ? ? -96.83 44.68 3 1 ASP A 47 ? ? 38.80 26.24 4 1 LEU A 53 ? ? -48.33 168.33 5 1 PRO A 65 ? ? -69.73 87.24 6 1 SER A 66 ? ? -54.77 103.98 7 2 ASP A 46 ? ? -96.89 45.14 8 2 ASP A 47 ? ? 37.89 27.59 9 2 LEU A 53 ? ? -48.17 168.88 10 3 PRO A 8 ? ? -69.82 88.65 11 3 ASP A 46 ? ? -92.34 43.54 12 3 ASP A 47 ? ? 39.23 25.81 13 3 LEU A 53 ? ? -46.09 168.34 14 3 SER A 66 ? ? -173.21 143.82 15 4 ASP A 46 ? ? -95.74 44.85 16 4 ASP A 47 ? ? 38.94 26.02 17 4 LEU A 53 ? ? -46.99 171.36 18 4 ALA A 60 ? ? -81.75 39.88 19 5 ARG A 9 ? ? -45.43 150.98 20 5 ASP A 46 ? ? -91.78 44.73 21 5 ASP A 47 ? ? 37.45 28.33 22 5 LEU A 53 ? ? -45.20 168.06 23 5 LEU A 62 ? ? -93.31 -60.90 24 5 PRO A 65 ? ? -69.77 89.43 25 6 PRO A 8 ? ? -69.76 2.79 26 6 TRP A 20 ? ? -100.36 -75.08 27 6 THR A 21 ? ? -56.50 176.83 28 6 ASP A 22 ? ? -34.41 -73.27 29 6 ILE A 30 ? ? -61.88 96.27 30 6 ASP A 46 ? ? -92.53 45.63 31 6 ASP A 47 ? ? 38.27 27.01 32 6 LEU A 53 ? ? -49.55 166.82 33 7 SER A 6 ? ? -101.78 44.76 34 7 PRO A 8 ? ? -69.79 81.01 35 7 ARG A 9 ? ? -47.74 153.39 36 7 ASP A 46 ? ? -94.13 44.66 37 7 ASP A 47 ? ? 37.76 28.01 38 7 LEU A 53 ? ? -49.22 168.17 39 7 ALA A 61 ? ? -48.45 157.55 40 8 THR A 21 ? ? -46.51 153.74 41 8 ASP A 46 ? ? -95.13 43.88 42 8 ASP A 47 ? ? 39.09 26.10 43 8 LEU A 53 ? ? -46.23 168.17 44 8 SER A 63 ? ? -173.27 142.03 45 9 SER A 5 ? ? -172.36 117.09 46 9 TRP A 20 ? ? -134.57 -74.26 47 9 ASP A 22 ? ? 71.06 43.72 48 9 ASP A 46 ? ? -95.02 44.44 49 9 ASP A 47 ? ? 38.98 26.04 50 9 LEU A 53 ? ? -47.06 166.91 51 10 ILE A 30 ? ? -60.38 97.46 52 10 ASP A 46 ? ? -93.77 44.63 53 10 ASP A 47 ? ? 38.29 26.89 54 10 LEU A 53 ? ? -45.23 171.06 55 10 PRO A 59 ? ? -69.73 98.58 56 11 ILE A 30 ? ? -62.36 99.68 57 11 ASP A 46 ? ? -92.02 46.24 58 11 ASP A 47 ? ? 35.64 31.22 59 11 LEU A 53 ? ? -46.62 169.89 60 11 SER A 67 ? ? -81.77 43.58 61 12 SER A 2 ? ? 38.01 42.52 62 12 ASP A 46 ? ? -92.67 44.59 63 12 ASP A 47 ? ? 38.09 27.35 64 12 LEU A 53 ? ? -45.03 168.57 65 12 ALA A 60 ? ? -113.74 79.90 66 13 PRO A 8 ? ? -69.75 1.42 67 13 THR A 21 ? ? -38.18 -39.47 68 13 ASP A 46 ? ? -92.87 44.98 69 13 ASP A 47 ? ? 37.94 27.58 70 13 LEU A 53 ? ? -49.59 166.62 71 13 ALA A 60 ? ? -94.03 41.00 72 14 TRP A 20 ? ? -133.01 -75.15 73 14 THR A 21 ? ? -57.51 -176.53 74 14 ASP A 22 ? ? -34.31 -73.50 75 14 ASP A 46 ? ? -89.85 43.96 76 14 ASP A 47 ? ? 38.91 26.79 77 14 LEU A 53 ? ? -47.06 168.34 78 14 ALA A 61 ? ? -49.65 104.56 79 15 ASP A 46 ? ? -91.30 44.87 80 15 ASP A 47 ? ? 38.82 26.18 81 15 LEU A 53 ? ? -50.67 173.35 82 15 ALA A 60 ? ? -95.79 40.47 83 16 SER A 3 ? ? -165.22 116.54 84 16 ARG A 9 ? ? -43.78 156.42 85 16 ASP A 46 ? ? -90.28 45.66 86 16 ASP A 47 ? ? 37.50 28.13 87 16 LEU A 53 ? ? -46.36 170.78 88 17 SER A 5 ? ? -165.06 113.31 89 17 THR A 21 ? ? 37.65 31.60 90 17 ILE A 30 ? ? -62.84 92.93 91 17 ASP A 46 ? ? -94.50 42.91 92 17 ASP A 47 ? ? 38.90 26.27 93 17 LEU A 53 ? ? -48.28 169.55 94 17 ALA A 61 ? ? -34.16 142.91 95 17 SER A 63 ? ? -174.82 118.38 96 17 PRO A 65 ? ? -69.76 1.78 97 18 SER A 2 ? ? -132.53 -44.38 98 18 ARG A 9 ? ? -131.25 -65.97 99 18 TRP A 20 ? ? -123.98 -69.72 100 18 ILE A 30 ? ? -62.59 97.56 101 18 ASP A 46 ? ? -93.05 42.64 102 18 ASP A 47 ? ? 38.77 26.15 103 18 LEU A 53 ? ? -48.78 169.74 104 18 PRO A 65 ? ? -69.77 98.83 105 19 SER A 3 ? ? -92.92 43.04 106 19 THR A 21 ? ? 33.80 33.87 107 19 ASP A 46 ? ? -89.22 44.89 108 19 ASP A 47 ? ? 37.42 28.30 109 19 LEU A 53 ? ? -45.59 169.29 110 20 SER A 3 ? ? -50.13 105.34 111 20 TRP A 20 ? ? -105.82 -70.70 112 20 ASP A 22 ? ? 70.93 36.07 113 20 ILE A 30 ? ? -60.57 99.85 114 20 ASP A 46 ? ? -91.66 44.62 115 20 ASP A 47 ? ? 38.62 26.63 116 20 LEU A 53 ? ? -46.61 167.77 #