data_2E61 # _entry.id 2E61 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2E61 RCSB RCSB026269 WWPDB D_1000026269 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hso003005504.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2E61 _pdbx_database_status.recvd_initial_deposition_date 2006-12-25 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'He, F.' 1 'Muto, Y.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Shirouzu, M.' 5 'Terada, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Structural insight into the zinc finger CW domain as a histone modification reader' _citation.journal_abbrev Structure _citation.journal_volume 18 _citation.page_first 1127 _citation.page_last 1139 _citation.year 2010 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20826339 _citation.pdbx_database_id_DOI 10.1016/j.str.2010.06.012 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'He, F.' 1 primary 'Umehara, T.' 2 primary 'Saito, K.' 3 primary 'Harada, T.' 4 primary 'Watanabe, S.' 5 primary 'Yabuki, T.' 6 primary 'Kigawa, T.' 7 primary 'Takahashi, M.' 8 primary 'Kuwasako, K.' 9 primary 'Tsuda, K.' 10 primary 'Matsuda, T.' 11 primary 'Aoki, M.' 12 primary 'Seki, E.' 13 primary 'Kobayashi, N.' 14 primary 'Guntert, P.' 15 primary 'Yokoyama, S.' 16 primary 'Muto, Y.' 17 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Zinc finger CW-type PWWP domain protein 1' 7648.352 1 ? ? 'zf-CW domain, UNP residues 246-307' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGEISGFGQCLVWVQCSFPNCGKWRRLCGNIDPSVLPDNWSCDQNTDVQYNRCDIPEETWTGLE _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGEISGFGQCLVWVQCSFPNCGKWRRLCGNIDPSVLPDNWSCDQNTDVQYNRCDIPEETWTGLE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hso003005504.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLU n 1 9 ILE n 1 10 SER n 1 11 GLY n 1 12 PHE n 1 13 GLY n 1 14 GLN n 1 15 CYS n 1 16 LEU n 1 17 VAL n 1 18 TRP n 1 19 VAL n 1 20 GLN n 1 21 CYS n 1 22 SER n 1 23 PHE n 1 24 PRO n 1 25 ASN n 1 26 CYS n 1 27 GLY n 1 28 LYS n 1 29 TRP n 1 30 ARG n 1 31 ARG n 1 32 LEU n 1 33 CYS n 1 34 GLY n 1 35 ASN n 1 36 ILE n 1 37 ASP n 1 38 PRO n 1 39 SER n 1 40 VAL n 1 41 LEU n 1 42 PRO n 1 43 ASP n 1 44 ASN n 1 45 TRP n 1 46 SER n 1 47 CYS n 1 48 ASP n 1 49 GLN n 1 50 ASN n 1 51 THR n 1 52 ASP n 1 53 VAL n 1 54 GLN n 1 55 TYR n 1 56 ASN n 1 57 ARG n 1 58 CYS n 1 59 ASP n 1 60 ILE n 1 61 PRO n 1 62 GLU n 1 63 GLU n 1 64 THR n 1 65 TRP n 1 66 THR n 1 67 GLY n 1 68 LEU n 1 69 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ZCWPW1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'cell free synthsis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060116-12 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'E. coli - cell free' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZCPW1_HUMAN _struct_ref.pdbx_db_accession Q9H0M4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code EISGFGQCLVWVQCSFPNCGKWRRLCGNIDPSVLPDNWSCDQNTDVQYNRCDIPEETWTGLE _struct_ref.pdbx_align_begin 246 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2E61 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 69 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9H0M4 _struct_ref_seq.db_align_beg 246 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 307 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 69 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2E61 GLY A 1 ? UNP Q9H0M4 ? ? 'EXPRESSION TAG' 1 1 1 2E61 SER A 2 ? UNP Q9H0M4 ? ? 'EXPRESSION TAG' 2 2 1 2E61 SER A 3 ? UNP Q9H0M4 ? ? 'EXPRESSION TAG' 3 3 1 2E61 GLY A 4 ? UNP Q9H0M4 ? ? 'EXPRESSION TAG' 4 4 1 2E61 SER A 5 ? UNP Q9H0M4 ? ? 'EXPRESSION TAG' 5 5 1 2E61 SER A 6 ? UNP Q9H0M4 ? ? 'EXPRESSION TAG' 6 6 1 2E61 GLY A 7 ? UNP Q9H0M4 ? ? 'EXPRESSION TAG' 7 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 50uM ZnCl2+1mM IDA; 10% D2O, 90% H2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model Avance _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2E61 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2E61 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2E61 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XWINNMR 2.6 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' Kujira 0.9819 'Kobayashi, N.' 4 'structure solution' CYANA 2.1 'Guntert, P.' 5 refinement CYANA 2.1 'Guntert, P.' 6 # _exptl.entry_id 2E61 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2E61 _struct.title 'Solution structure of the zf-CW domain in zinc finger CW-type PWWP domain protein 1' _struct.pdbx_descriptor 'Zinc finger CW-type PWWP domain protein 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2E61 _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;zf-CW domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 38 ? VAL A 40 ? PRO A 38 VAL A 40 5 ? 3 HELX_P HELX_P2 1 CYS A 47 ? GLN A 49 ? CYS A 47 GLN A 49 5 ? 3 HELX_P HELX_P3 2 VAL A 53 ? TYR A 55 ? VAL A 53 TYR A 55 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 21 SG ? ? A ZN 201 A CYS 21 1_555 ? ? ? ? ? ? ? 2.252 ? metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 26 SG ? ? A ZN 201 A CYS 26 1_555 ? ? ? ? ? ? ? 2.343 ? metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 47 SG ? ? A ZN 201 A CYS 47 1_555 ? ? ? ? ? ? ? 2.336 ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 58 SG ? ? A ZN 201 A CYS 58 1_555 ? ? ? ? ? ? ? 2.338 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 18 ? GLN A 20 ? TRP A 18 GLN A 20 A 2 TRP A 29 ? ARG A 31 ? TRP A 29 ARG A 31 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id VAL _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 19 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 19 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ARG _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 30 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ARG _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 30 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 2 AC1 4 CYS A 26 ? CYS A 26 . ? 1_555 ? 3 AC1 4 CYS A 47 ? CYS A 47 . ? 1_555 ? 4 AC1 4 CYS A 58 ? CYS A 58 . ? 1_555 ? # _database_PDB_matrix.entry_id 2E61 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2E61 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 TRP 18 18 18 TRP TRP A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 TRP 29 29 29 TRP TRP A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 TRP 45 45 45 TRP TRP A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 CYS 58 58 58 CYS CYS A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 TRP 65 65 65 TRP TRP A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 GLU 69 69 69 GLU GLU A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 201 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 26 ? A CYS 26 ? 1_555 113.7 ? 2 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 47 ? A CYS 47 ? 1_555 106.5 ? 3 SG ? A CYS 26 ? A CYS 26 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 47 ? A CYS 47 ? 1_555 110.1 ? 4 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 58 ? A CYS 58 ? 1_555 114.0 ? 5 SG ? A CYS 26 ? A CYS 26 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 58 ? A CYS 58 ? 1_555 102.2 ? 6 SG ? A CYS 47 ? A CYS 47 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 58 ? A CYS 58 ? 1_555 110.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-06-26 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX DETERMINATION METHOD: AUTHOR DETERMINED ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 26 ? ? -86.91 -75.79 2 1 ASN A 44 ? ? -98.24 33.77 3 1 TYR A 55 ? ? -145.06 53.33 4 2 CYS A 26 ? ? -86.79 -76.00 5 2 VAL A 40 ? ? -93.18 42.14 6 2 PRO A 42 ? ? -69.75 -173.81 7 2 ASN A 44 ? ? -115.00 51.88 8 2 TYR A 55 ? ? -144.99 53.45 9 3 SER A 3 ? ? -53.56 107.21 10 3 SER A 6 ? ? -107.13 -71.10 11 3 CYS A 26 ? ? -86.77 -75.82 12 3 ASN A 35 ? ? -99.70 41.94 13 3 TYR A 55 ? ? -145.23 53.16 14 4 CYS A 26 ? ? -86.70 -76.04 15 4 TYR A 55 ? ? -145.15 53.40 16 4 GLU A 63 ? ? -68.54 -178.91 17 4 LEU A 68 ? ? -91.19 -72.31 18 5 CYS A 26 ? ? -86.65 -75.70 19 5 ASN A 35 ? ? -93.98 42.15 20 5 ASN A 44 ? ? -111.95 60.59 21 5 TYR A 55 ? ? -145.52 53.21 22 5 THR A 66 ? ? -98.93 41.42 23 6 GLN A 14 ? ? -104.76 -68.96 24 6 CYS A 26 ? ? -86.90 -75.82 25 6 VAL A 40 ? ? -94.80 39.25 26 6 PRO A 42 ? ? -69.76 -172.99 27 6 TYR A 55 ? ? -145.65 53.11 28 7 CYS A 26 ? ? -87.08 -75.83 29 7 ASN A 35 ? ? -93.17 49.14 30 7 ASN A 44 ? ? -111.79 59.96 31 7 TYR A 55 ? ? -145.44 53.30 32 7 GLU A 63 ? ? -54.77 108.27 33 8 LEU A 16 ? ? -165.43 118.26 34 8 CYS A 26 ? ? -86.17 -75.88 35 8 ASN A 35 ? ? -95.80 36.03 36 8 TYR A 55 ? ? -145.30 53.47 37 9 SER A 2 ? ? -172.42 120.08 38 9 SER A 5 ? ? -108.51 42.82 39 9 PHE A 12 ? ? -118.18 55.26 40 9 CYS A 26 ? ? -86.86 -75.94 41 9 CYS A 33 ? ? -66.48 -75.13 42 9 PRO A 42 ? ? -69.78 -175.19 43 9 ASN A 44 ? ? -99.49 31.04 44 9 TYR A 55 ? ? -145.14 53.24 45 10 SER A 5 ? ? -64.45 -179.32 46 10 ILE A 9 ? ? -66.30 -176.94 47 10 PHE A 12 ? ? -68.33 -72.34 48 10 CYS A 26 ? ? -86.94 -76.14 49 10 PRO A 42 ? ? -69.72 -170.75 50 10 TYR A 55 ? ? -145.34 53.23 51 10 LEU A 68 ? ? -60.36 -179.54 52 11 SER A 5 ? ? -105.49 69.49 53 11 SER A 10 ? ? -121.34 -52.76 54 11 CYS A 26 ? ? -87.33 -75.83 55 11 ASN A 35 ? ? -97.90 44.24 56 11 ASN A 44 ? ? -98.36 31.85 57 11 TYR A 55 ? ? -144.30 52.29 58 12 SER A 6 ? ? -105.59 -68.51 59 12 SER A 10 ? ? -103.59 40.22 60 12 CYS A 26 ? ? -87.15 -75.83 61 12 ASN A 44 ? ? -99.45 34.90 62 12 TYR A 55 ? ? -144.47 52.15 63 13 CYS A 26 ? ? -86.98 -75.76 64 13 TYR A 55 ? ? -144.76 52.60 65 13 GLU A 63 ? ? -53.41 171.79 66 14 CYS A 26 ? ? -86.79 -75.83 67 14 CYS A 33 ? ? -54.85 -72.99 68 14 TYR A 55 ? ? -143.91 52.56 69 14 GLU A 63 ? ? -67.65 -71.11 70 15 CYS A 26 ? ? -86.79 -75.62 71 15 TYR A 55 ? ? -144.28 52.29 72 16 CYS A 26 ? ? -86.80 -75.71 73 16 ASN A 44 ? ? -116.91 65.38 74 16 TYR A 55 ? ? -144.21 52.36 75 17 SER A 2 ? ? -101.71 58.28 76 17 CYS A 26 ? ? -87.04 -75.75 77 17 CYS A 33 ? ? -69.00 -72.45 78 17 ASN A 44 ? ? -99.01 31.19 79 17 TYR A 55 ? ? -144.48 52.50 80 17 GLU A 63 ? ? -54.95 175.04 81 18 LEU A 16 ? ? -101.77 78.05 82 18 CYS A 26 ? ? -87.00 -75.78 83 18 CYS A 33 ? ? -59.96 -177.47 84 18 TYR A 55 ? ? -144.60 52.57 85 19 CYS A 26 ? ? -86.88 -76.13 86 19 ASN A 44 ? ? -97.01 34.23 87 19 TYR A 55 ? ? -143.76 52.55 88 19 GLU A 63 ? ? -95.29 -65.82 89 19 TRP A 65 ? ? -97.39 36.93 90 20 GLU A 8 ? ? -95.06 39.28 91 20 SER A 10 ? ? -95.48 56.01 92 20 GLN A 14 ? ? -174.73 130.16 93 20 CYS A 26 ? ? -86.79 -75.85 94 20 ASN A 35 ? ? -99.08 31.37 95 20 VAL A 40 ? ? -93.09 42.39 96 20 PRO A 42 ? ? -69.76 -172.78 97 20 ASN A 44 ? ? -115.37 52.21 98 20 TYR A 55 ? ? -143.82 52.53 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #