data_2E6O # _entry.id 2E6O # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2E6O pdb_00002e6o 10.2210/pdb2e6o/pdb RCSB RCSB026292 ? ? WWPDB D_1000026292 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002014558.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2E6O _pdbx_database_status.recvd_initial_deposition_date 2006-12-28 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Qin, X.R.' 1 'Hayashi, F.' 2 'Yokoyama, S.' 3 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 # _citation.id primary _citation.title 'Solution structure of the HMG box domain from human HMG-box transcription factor 1' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Qin, X.R.' 1 ? primary 'Hayashi, F.' 2 ? primary 'Yokoyama, S.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'HMG box-containing protein 1' _entity.formula_weight 9999.562 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment HMG-box _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'HMG box transcription factor 1, High mobility group box transcription factor 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGGTVSATSPNKCKRPMNAFMLFAKKYRVEYTQMYPGKDNRAISVILGDRWKKMKNEERRMYTLEAKALAEEQKR LNPDCWK ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGGTVSATSPNKCKRPMNAFMLFAKKYRVEYTQMYPGKDNRAISVILGDRWKKMKNEERRMYTLEAKALAEEQKR LNPDCWK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002014558.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLY n 1 9 THR n 1 10 VAL n 1 11 SER n 1 12 ALA n 1 13 THR n 1 14 SER n 1 15 PRO n 1 16 ASN n 1 17 LYS n 1 18 CYS n 1 19 LYS n 1 20 ARG n 1 21 PRO n 1 22 MET n 1 23 ASN n 1 24 ALA n 1 25 PHE n 1 26 MET n 1 27 LEU n 1 28 PHE n 1 29 ALA n 1 30 LYS n 1 31 LYS n 1 32 TYR n 1 33 ARG n 1 34 VAL n 1 35 GLU n 1 36 TYR n 1 37 THR n 1 38 GLN n 1 39 MET n 1 40 TYR n 1 41 PRO n 1 42 GLY n 1 43 LYS n 1 44 ASP n 1 45 ASN n 1 46 ARG n 1 47 ALA n 1 48 ILE n 1 49 SER n 1 50 VAL n 1 51 ILE n 1 52 LEU n 1 53 GLY n 1 54 ASP n 1 55 ARG n 1 56 TRP n 1 57 LYS n 1 58 LYS n 1 59 MET n 1 60 LYS n 1 61 ASN n 1 62 GLU n 1 63 GLU n 1 64 ARG n 1 65 ARG n 1 66 MET n 1 67 TYR n 1 68 THR n 1 69 LEU n 1 70 GLU n 1 71 ALA n 1 72 LYS n 1 73 ALA n 1 74 LEU n 1 75 ALA n 1 76 GLU n 1 77 GLU n 1 78 GLN n 1 79 LYS n 1 80 ARG n 1 81 LEU n 1 82 ASN n 1 83 PRO n 1 84 ASP n 1 85 CYS n 1 86 TRP n 1 87 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene HBP1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060206-06 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HBP1_HUMAN _struct_ref.pdbx_db_accession O60381 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GTVSATSPNKCKRPMNAFMLFAKKYRVEYTQMYPGKDNRAISVILGDRWKKMKNEERRMYTLEAKALAEEQKRLNPDCWK ; _struct_ref.pdbx_align_begin 424 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2E6O _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 87 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O60381 _struct_ref_seq.db_align_beg 424 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 503 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 87 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2E6O GLY A 1 ? UNP O60381 ? ? 'cloning artifact' 1 1 1 2E6O SER A 2 ? UNP O60381 ? ? 'cloning artifact' 2 2 1 2E6O SER A 3 ? UNP O60381 ? ? 'cloning artifact' 3 3 1 2E6O GLY A 4 ? UNP O60381 ? ? 'cloning artifact' 4 4 1 2E6O SER A 5 ? UNP O60381 ? ? 'cloning artifact' 5 5 1 2E6O SER A 6 ? UNP O60381 ? ? 'cloning artifact' 6 6 1 2E6O GLY A 7 ? UNP O60381 ? ? 'cloning artifact' 7 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1.16mM 13C,15N-labeled protein; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10%D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2E6O _pdbx_nmr_refine.method 'Torsion angle dynamic' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2E6O _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2E6O _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9816 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2E6O _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2E6O _struct.title 'Solution structure of the HMG box domain from human HMG-box transcription factor 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2E6O _struct_keywords.pdbx_keywords 'TRANSCRIPTION, CELL CYCLE' _struct_keywords.text ;HMG-box domain, HMG box containing protein 1, HMG-box transcription factor 1, High mobility group box transcription factor 1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION, CELL CYCLE ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 23 ? TYR A 32 ? ASN A 23 TYR A 32 1 ? 10 HELX_P HELX_P2 2 TYR A 32 ? TYR A 40 ? TYR A 32 TYR A 40 1 ? 9 HELX_P HELX_P3 3 ASP A 44 ? MET A 59 ? ASP A 44 MET A 59 1 ? 16 HELX_P HELX_P4 4 LYS A 60 ? ASN A 82 ? LYS A 60 ASN A 82 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2E6O _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2E6O _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 TRP 56 56 56 TRP TRP A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 MET 59 59 59 MET MET A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 MET 66 66 66 MET MET A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 CYS 85 85 85 CYS CYS A . n A 1 86 TRP 86 86 86 TRP TRP A . n A 1 87 LYS 87 87 87 LYS LYS A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-07-03 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 3 ? ? -173.48 140.59 2 1 SER A 5 ? ? -59.52 -175.52 3 1 SER A 14 ? ? 59.24 72.44 4 1 PRO A 15 ? ? -69.76 -174.79 5 1 CYS A 18 ? ? -58.94 177.31 6 1 ARG A 33 ? ? -60.16 -73.22 7 1 MET A 59 ? ? -54.38 173.65 8 1 ASN A 82 ? ? -115.51 71.31 9 2 ARG A 33 ? ? -61.22 -70.07 10 2 ASN A 82 ? ? -114.79 73.41 11 2 CYS A 85 ? ? -95.89 33.91 12 3 SER A 2 ? ? -117.72 55.20 13 3 TRP A 86 ? ? -112.95 52.66 14 4 SER A 5 ? ? -67.48 99.81 15 4 CYS A 18 ? ? -113.42 69.89 16 4 ASN A 23 ? ? -54.13 171.62 17 4 ASN A 82 ? ? -118.11 71.50 18 4 TRP A 86 ? ? -109.36 43.49 19 5 VAL A 10 ? ? 54.24 73.45 20 5 PRO A 15 ? ? -69.74 80.25 21 5 ASN A 23 ? ? -52.91 171.14 22 5 ARG A 33 ? ? -67.49 -70.25 23 5 ASN A 82 ? ? -118.63 69.88 24 6 ASN A 23 ? ? -58.79 -176.16 25 6 MET A 59 ? ? -56.53 175.94 26 6 ASN A 82 ? ? -119.17 71.08 27 7 CYS A 18 ? ? -61.74 95.52 28 7 ARG A 20 ? ? 63.16 160.60 29 7 PRO A 21 ? ? -69.79 91.10 30 7 ASN A 23 ? ? -54.60 173.27 31 7 MET A 59 ? ? -57.14 174.30 32 7 ASN A 82 ? ? -118.87 73.79 33 8 SER A 11 ? ? -123.22 -53.59 34 8 SER A 14 ? ? -179.30 70.06 35 8 ASN A 82 ? ? -115.70 73.45 36 9 SER A 11 ? ? -100.61 45.09 37 9 ARG A 20 ? ? 63.04 160.60 38 9 ARG A 33 ? ? -66.20 -73.15 39 9 TRP A 86 ? ? -96.09 59.74 40 10 SER A 14 ? ? 62.98 160.48 41 10 ASN A 23 ? ? -58.54 177.32 42 10 ARG A 33 ? ? -61.47 -70.30 43 10 MET A 59 ? ? -58.02 175.44 44 11 PRO A 21 ? ? -69.69 89.76 45 11 ASN A 23 ? ? -68.16 -174.37 46 11 ASN A 82 ? ? -113.73 73.70 47 11 ASP A 84 ? ? -113.13 51.80 48 12 SER A 14 ? ? -116.94 73.01 49 12 CYS A 18 ? ? -58.83 178.43 50 12 PRO A 21 ? ? -69.79 -175.08 51 12 MET A 22 ? ? -69.51 90.54 52 12 ASN A 23 ? ? -58.19 -178.68 53 12 MET A 59 ? ? -58.32 175.70 54 13 THR A 9 ? ? -98.51 35.71 55 13 ARG A 20 ? ? 63.14 160.63 56 13 ARG A 33 ? ? -62.21 -72.08 57 13 ASN A 82 ? ? -118.91 72.36 58 14 ASN A 23 ? ? -59.19 -176.16 59 14 ARG A 33 ? ? -66.75 -72.16 60 14 ASN A 82 ? ? -117.90 71.01 61 14 TRP A 86 ? ? -113.33 69.87 62 15 SER A 2 ? ? -162.86 114.46 63 15 PRO A 15 ? ? -69.79 95.38 64 15 ARG A 20 ? ? 63.00 160.55 65 15 ASN A 23 ? ? -54.20 173.48 66 15 MET A 59 ? ? -54.26 173.27 67 15 ASN A 82 ? ? -119.75 69.92 68 16 VAL A 10 ? ? -58.76 -178.33 69 16 SER A 14 ? ? -175.38 68.55 70 16 PRO A 15 ? ? -69.77 82.79 71 16 ASN A 23 ? ? -61.67 -169.86 72 16 ASN A 82 ? ? -115.08 74.38 73 17 LYS A 17 ? ? -100.78 58.62 74 17 ASN A 23 ? ? -57.33 -179.81 75 17 ASN A 82 ? ? -119.13 68.37 76 18 ALA A 12 ? ? -103.67 55.08 77 18 SER A 14 ? ? -167.70 72.14 78 18 PRO A 15 ? ? -69.73 96.59 79 18 ASN A 23 ? ? -69.62 -175.26 80 18 MET A 59 ? ? -55.79 173.91 81 19 SER A 11 ? ? -102.60 73.22 82 19 SER A 14 ? ? 62.76 160.64 83 19 ASN A 23 ? ? -60.44 -175.16 84 19 ARG A 33 ? ? -68.31 -71.60 85 19 MET A 59 ? ? -55.48 174.86 86 19 TRP A 86 ? ? -104.88 67.81 87 20 SER A 5 ? ? -130.30 -74.30 88 20 LYS A 19 ? ? -71.87 -75.28 89 20 ARG A 20 ? ? 62.97 160.57 90 20 PRO A 21 ? ? -69.74 -175.94 91 20 ARG A 33 ? ? -66.06 -71.69 92 20 ASP A 84 ? ? -110.54 55.10 #