data_2E8M # _entry.id 2E8M # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2E8M pdb_00002e8m 10.2210/pdb2e8m/pdb RCSB RCSB026362 ? ? WWPDB D_1000026362 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hso002000428.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2E8M _pdbx_database_status.recvd_initial_deposition_date 2007-01-22 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Goroncy, A.K.' 1 'Sato, M.' 2 'Koshiba, S.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution structure of the C-terminal SAM-domain of epidermal growth receptor pathway substrate 8' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Goroncy, A.K.' 1 ? primary 'Sato, M.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Yokoyama, S.' 6 ? # _cell.entry_id 2E8M _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2E8M _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Epidermal growth factor receptor kinase substrate 8' _entity.formula_weight 10458.687 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SAM domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'epidermal growth receptor pathway substrate 8' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGTIGRSAAQKKFHVPRQNVPVINITYDSTPEDVKTWLQSKGFNPVTVNSLGVLNGAQLFSLNKDELRTVCPEGA RVYSQITVQKAALSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGTIGRSAAQKKFHVPRQNVPVINITYDSTPEDVKTWLQSKGFNPVTVNSLGVLNGAQLFSLNKDELRTVCPEGA RVYSQITVQKAALSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hso002000428.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 THR n 1 9 ILE n 1 10 GLY n 1 11 ARG n 1 12 SER n 1 13 ALA n 1 14 ALA n 1 15 GLN n 1 16 LYS n 1 17 LYS n 1 18 PHE n 1 19 HIS n 1 20 VAL n 1 21 PRO n 1 22 ARG n 1 23 GLN n 1 24 ASN n 1 25 VAL n 1 26 PRO n 1 27 VAL n 1 28 ILE n 1 29 ASN n 1 30 ILE n 1 31 THR n 1 32 TYR n 1 33 ASP n 1 34 SER n 1 35 THR n 1 36 PRO n 1 37 GLU n 1 38 ASP n 1 39 VAL n 1 40 LYS n 1 41 THR n 1 42 TRP n 1 43 LEU n 1 44 GLN n 1 45 SER n 1 46 LYS n 1 47 GLY n 1 48 PHE n 1 49 ASN n 1 50 PRO n 1 51 VAL n 1 52 THR n 1 53 VAL n 1 54 ASN n 1 55 SER n 1 56 LEU n 1 57 GLY n 1 58 VAL n 1 59 LEU n 1 60 ASN n 1 61 GLY n 1 62 ALA n 1 63 GLN n 1 64 LEU n 1 65 PHE n 1 66 SER n 1 67 LEU n 1 68 ASN n 1 69 LYS n 1 70 ASP n 1 71 GLU n 1 72 LEU n 1 73 ARG n 1 74 THR n 1 75 VAL n 1 76 CYS n 1 77 PRO n 1 78 GLU n 1 79 GLY n 1 80 ALA n 1 81 ARG n 1 82 VAL n 1 83 TYR n 1 84 SER n 1 85 GLN n 1 86 ILE n 1 87 THR n 1 88 VAL n 1 89 GLN n 1 90 LYS n 1 91 ALA n 1 92 ALA n 1 93 LEU n 1 94 SER n 1 95 GLY n 1 96 PRO n 1 97 SER n 1 98 SER n 1 99 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene EPS8 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050613-05 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'CELL-FREE PROTEIN SYNTHESIS' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EPS8_HUMAN _struct_ref.pdbx_db_accession Q12929 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TIGRSAAQKKFHVPRQNVPVINITYDSTPEDVKTWLQSKGFNPVTVNSLGVLNGAQLFSLNKDELRTVCPEGARVYSQIT VQKAAL ; _struct_ref.pdbx_align_begin 699 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2E8M _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 93 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q12929 _struct_ref_seq.db_align_beg 699 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 784 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 93 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2E8M GLY A 1 ? UNP Q12929 ? ? 'cloning artifact' 1 1 1 2E8M SER A 2 ? UNP Q12929 ? ? 'cloning artifact' 2 2 1 2E8M SER A 3 ? UNP Q12929 ? ? 'cloning artifact' 3 3 1 2E8M GLY A 4 ? UNP Q12929 ? ? 'cloning artifact' 4 4 1 2E8M SER A 5 ? UNP Q12929 ? ? 'cloning artifact' 5 5 1 2E8M SER A 6 ? UNP Q12929 ? ? 'cloning artifact' 6 6 1 2E8M GLY A 7 ? UNP Q12929 ? ? 'cloning artifact' 7 7 1 2E8M SER A 94 ? UNP Q12929 ? ? 'cloning artifact' 94 8 1 2E8M GLY A 95 ? UNP Q12929 ? ? 'cloning artifact' 95 9 1 2E8M PRO A 96 ? UNP Q12929 ? ? 'cloning artifact' 96 10 1 2E8M SER A 97 ? UNP Q12929 ? ? 'cloning artifact' 97 11 1 2E8M SER A 98 ? UNP Q12929 ? ? 'cloning artifact' 98 12 1 2E8M GLY A 99 ? UNP Q12929 ? ? 'cloning artifact' 99 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.04mM SAM DOMAIN, 20mM d-TRIS-HCL, 100mM NaCl, 1mM d-DTT, 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2E8M _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2E8M _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2E8M _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CYANA 2.1 'P.GUNTERT ET AL.' 1 'structure solution' CYANA 2.1 'P.GUNTERT ET AL.' 2 collection XwinNMR 3.5 BRUKER 3 processing NMRPipe 2003112 'FRANK DELAGLIO' 4 'data analysis' NMRView 5.0.4 'BRUCE A. JOHNSON' 5 'data analysis' KUJIRA 0.899a 'NAOHIRO KOBAYASHI' 6 # _exptl.entry_id 2E8M _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2E8M _struct.title 'Solution structure of the C-terminal SAM-domain of epidermal growth receptor pathway substrate 8' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2E8M _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text ;CELL-FREE PROTEIN SYNTHESIS, PROTEIN REGULATION, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 37 ? GLY A 47 ? GLU A 37 GLY A 47 1 ? 11 HELX_P HELX_P2 2 ASN A 49 ? LEU A 56 ? ASN A 49 LEU A 56 1 ? 8 HELX_P HELX_P3 3 ASN A 60 ? LEU A 67 ? ASN A 60 LEU A 67 1 ? 8 HELX_P HELX_P4 4 ASN A 68 ? CYS A 76 ? ASN A 68 CYS A 76 1 ? 9 HELX_P HELX_P5 5 GLU A 78 ? SER A 94 ? GLU A 78 SER A 94 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2E8M _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2E8M _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 TRP 42 42 42 TRP TRP A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 CYS 76 76 76 CYS CYS A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 GLY 99 99 99 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-07-24 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 12 ? ? -172.93 -69.59 2 1 HIS A 19 ? ? 55.79 77.23 3 1 ARG A 22 ? ? -134.88 -62.43 4 1 SER A 97 ? ? 61.94 -179.96 5 2 LYS A 16 ? ? 55.17 72.01 6 3 SER A 3 ? ? 61.28 170.67 7 3 HIS A 19 ? ? -152.89 81.57 8 3 SER A 97 ? ? -108.19 -73.62 9 4 SER A 2 ? ? -101.59 -62.97 10 4 SER A 3 ? ? -136.21 -64.13 11 4 LYS A 16 ? ? -149.60 -71.77 12 4 SER A 94 ? ? -64.08 -171.08 13 4 SER A 97 ? ? 54.89 -170.47 14 5 SER A 3 ? ? 54.12 81.87 15 5 SER A 12 ? ? -172.50 56.52 16 5 ALA A 14 ? ? 53.65 82.49 17 5 HIS A 19 ? ? -173.86 33.68 18 5 ARG A 22 ? ? -166.02 55.66 19 5 PRO A 96 ? ? -69.76 89.03 20 5 SER A 98 ? ? 62.89 173.40 21 6 SER A 2 ? ? -144.47 58.94 22 6 SER A 6 ? ? 52.70 85.28 23 6 ALA A 13 ? ? -141.09 -68.26 24 6 ASN A 24 ? ? -173.17 35.60 25 7 SER A 12 ? ? -117.99 65.12 26 7 ALA A 13 ? ? -151.17 49.58 27 8 SER A 5 ? ? -156.35 68.93 28 8 SER A 6 ? ? -102.67 -64.24 29 8 SER A 12 ? ? -141.40 43.63 30 8 LYS A 16 ? ? -123.54 -72.11 31 8 ASN A 24 ? ? -99.67 48.52 32 8 SER A 98 ? ? -164.18 -58.76 33 9 SER A 3 ? ? -124.34 -67.17 34 9 SER A 12 ? ? -165.56 -47.76 35 9 ALA A 14 ? ? -105.73 70.06 36 10 SER A 5 ? ? -166.25 33.57 37 10 SER A 6 ? ? -160.61 93.27 38 10 SER A 12 ? ? -149.39 -51.69 39 10 ALA A 14 ? ? -173.74 -48.04 40 10 ARG A 22 ? ? 58.98 95.30 41 10 ASN A 24 ? ? -152.09 43.81 42 10 SER A 98 ? ? -176.40 111.78 43 11 SER A 2 ? ? -139.59 -45.53 44 11 THR A 8 ? ? -142.73 -49.41 45 11 ALA A 13 ? ? -107.90 -62.45 46 11 LYS A 16 ? ? 58.33 -176.96 47 11 LYS A 17 ? ? 60.14 -177.42 48 11 HIS A 19 ? ? -172.97 103.31 49 11 ARG A 22 ? ? -57.55 100.08 50 11 PRO A 96 ? ? -69.71 98.58 51 12 SER A 5 ? ? -96.60 57.42 52 12 SER A 6 ? ? -154.38 -41.95 53 12 SER A 12 ? ? -174.60 102.52 54 12 HIS A 19 ? ? 62.97 169.89 55 12 ARG A 22 ? ? -96.72 34.83 56 13 LYS A 16 ? ? -162.20 101.58 57 13 ARG A 22 ? ? -101.68 -61.82 58 14 SER A 5 ? ? -140.22 -52.25 59 14 SER A 12 ? ? -106.45 59.59 60 14 ALA A 13 ? ? -143.17 29.63 61 14 ALA A 14 ? ? 69.02 -77.15 62 14 LYS A 16 ? ? -106.28 44.88 63 15 THR A 8 ? ? 72.50 -68.71 64 15 ARG A 22 ? ? -172.65 -55.90 65 15 ASN A 24 ? ? -149.17 36.94 66 15 ASN A 68 ? ? -106.58 -169.90 67 15 SER A 94 ? ? 60.61 71.72 68 15 SER A 97 ? ? -170.40 -41.55 69 16 ALA A 13 ? ? 69.08 -77.10 70 16 LYS A 16 ? ? 56.54 -176.49 71 16 LYS A 17 ? ? 55.69 72.08 72 16 PRO A 96 ? ? -69.73 84.80 73 17 SER A 5 ? ? 69.30 -75.72 74 17 SER A 6 ? ? -100.65 60.45 75 17 HIS A 19 ? ? 61.95 73.97 76 17 PRO A 96 ? ? -69.78 -171.29 77 18 SER A 2 ? ? 69.34 -75.71 78 18 SER A 3 ? ? -160.21 119.35 79 18 SER A 6 ? ? -151.75 60.11 80 18 LYS A 16 ? ? 58.93 90.29 81 18 PRO A 96 ? ? -69.73 90.83 82 20 SER A 2 ? ? 60.94 179.76 83 20 SER A 3 ? ? 54.05 77.91 84 20 SER A 97 ? ? 62.74 85.01 #